CAZyme Information: MGYG000000988_00921

Basic Information

• Species: Anaerostipes rhamnosivorans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerostipes; Anaerostipes rhamnosivorans
• CAZyme ID: MGYG000000988_00921
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283	MGYG000000988_21|CGC1	33830.89	10.675

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000988	3481555	MAG	Denmark	Europe

• Gene Location: Start: 4222; End: 5073 Strand: -

Full Sequence      

MAGYTKNWTVKVVCILTAVMIMTGQPAEVQAAKKNKFTYTYGVFLNAGRKEINKFKKYKT
IVIDAQYFKKKDIRKLKKQGHIVYSYINIGSLEHFRPYYKKYRKYTMKPYENWDGEYWVD
VSQKPWQRKIKQLAGQLNGKGVDGFFVDNCDVYAEFPKKKIYRGLKKILCHLRSYRKKAV
ILNGGDTFVRKFYKNNRKLGPILTGVNQEEVFTRIDFKGRKLRKARVEDRKYFLDYLNLV
AGRKKKVYLLEYTKDPDLKKSIRRYCRKKHWKCYITKSVNLRF

Enzyme Prediction     

No EC number prediction in MGYG000000988_00921.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	60	277	8.5e-59	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3868	COG3868	8.94e-14	56	278	78	300	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
pfam03537	Glyco_hydro_114	3.25e-13	79	154	38	113	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG2342	COG2342	4.66e-12	56	276	42	278	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
TIGR01370	TIGR01370	6.82e-04	79	255	93	275	extracellular protein. Original assignment of this protein family as cysteinyl-tRNA synthetase is controversial, supported by but challenged by and by subsequent discovery of the actual mechanism for synthesizing Cys-tRNA in species where a direct Cys--tRNA ligase was not found. Lingering legacy annotations of members of this family probably should be removed. Evidence against the role includes a signal peptide. This family as been renamed "extracellular protein" to facilitate correction. Members of this family occur in Deinococcus radiodurans (bacterial) and Methanococcus jannaschii (archaeal). A number of homologous but more distantly related proteins are annotated as alpha-1,4 polygalactosaminidases. The function remains unknown. [Unknown function, General]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP36010.1	2.76e-212	1	283	1	283
QHI71547.1	1.10e-87	6	281	2	271
AOZ95737.1	9.02e-72	7	282	13	286
AEB30961.1	7.06e-70	16	281	9	279
ASS41767.1	7.02e-69	15	281	5	266

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000276	0.999054	0.000201	0.000152	0.000148	0.000142

TMHMM  Annotations     

start	end
7	29