CAZyme Information: MGYG000000982_00391

Basic Information

• Species: CAG-354 sp900552655
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-354; CAG-354 sp900552655
• CAZyme ID: MGYG000000982_00391
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792	MGYG000000982_8|CGC1	90867.48	5.1651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000982	1595406	MAG	Denmark	Europe

• Gene Location: Start: 8417; End: 10795 Strand: +

Full Sequence      

MKYKEIIQKMSLEEKAELCVGADYWSSKSFEKYEIPKIRMSDGPHGLRVQKTKADNLGIN
ESEVSTCFPASSTLGNSWNKEMAYQLGKALGEEARQEEVNIVLGPAINIKRSPLCGRNFE
YFSEDPYLTGILGAEYVKGLQDQNVGACVKHFAVNNQENRRRTIDVIVDERALREIYLKA
FEIIIKDAKPWSIMSAYNKVNGQYCSENTHLLEDILRKEWEYQGIVISDWGAENDRVKGI
ENGHELEMPGGRGNGKEEIIEAVKTGKVPESKLDSIVDRIISIAKQGEHIQECIKYDAEE
HHKIAQTIAEESIVLLKNEENILPIRNKKIALIGDMAKYPRYQGAGSSTINPYKIENAYN
SFKENNIVFDYAKGYERIESENDEVLRKEAIEIAKKNEIVVIFVGLTENFESEGVDRDSL
NIPDNQNKLIEEIYKVNKNIVIVLSNGAPITMPWKDKVKAIITGYLGGEAGAKAMANCLM
GKVNPSGKLAETYPIALEATPCYKNYPGTELTVEYQESIYVGYRYYDTNNIEVLFPFGYG
LSYTNFEYSNLQVDNNEDTIRILFTIKNIGMQKGKEIAQIYLSQENSKIFKPQKELREFT
KVELDIGEEKQVEIILNKKDFEYFNPETNKWSLEQGKYKILVGKSSKDIVLEKEIFIESK
DKNVEKNYSPNYYTGNVQKIKDEEFEELLGRSIPKRHLELEEITAENTLEQIKETKIGKF
IYENQMEKMNKLLKEQNVNKATKVMMDLQKPLKKFYEKKSSKITKEMVEDLIRIAKSNEN
FEDNAFVKEYLK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	249	3.2e-67	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.04e-87	66	649	118	757	beta-glucosidase BglX.
COG1472	BglX	1.13e-71	35	354	60	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.85e-60	313	543	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	8.38e-55	41	658	88	778	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.31e-37	66	283	86	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK49185.1	1.25e-248	1	694	1	695
AZK48658.1	2.13e-248	1	694	1	696
AOZ92946.1	2.78e-248	1	693	1	694
AST96263.1	7.13e-248	1	694	1	695
QNM42622.1	7.13e-248	1	694	1	695

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.49e-236	4	671	6	681	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.80e-169	7	649	9	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.61e-149	2	652	3	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.15e-148	2	652	3	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.41e-116	4	660	7	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	8.15e-236	4	671	6	681	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	6.12e-170	7	662	9	677	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	3.81e-168	7	649	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	2.03e-140	1	649	44	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	2.08e-130	4	670	12	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999510	0.000528	0.000002	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000982_00391.