CAZyme Information: MGYG000000973_00686

Basic Information

• Species: UMGS1490 sp900552245
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; UMGS1490; UMGS1490 sp900552245
• CAZyme ID: MGYG000000973_00686
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000000973_29|CGC1	43954.52	9.0553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000973	2116765	MAG	Australia	Oceania

• Gene Location: Start: 13950; End: 15122 Strand: +

Full Sequence      

MTRLETPESFNLPPPEDDACDLLIIAGEHSGDEQAARMMRRVLEKNPDLRVCALGGKALK
RVGVQLLFDMTKFSVVGLMEVLKNYSYFKKLLAEVYEWIAKYKPRAVCFVDYPGFNLELA
RMLKSGGLSKKGGGSVKLLYYISPQIWAWKAHRRFKMAELLDELAVIFPFETKCYADTTL
DTTFVGHPFLSPEYESKFYYDKDGPILFMPGSRKIAVGKIFPIMLRTLRLLEGQRALVPY
PSKGILEVLEQALEKFPDLKQRVSLQKISHLDKIGAKAVLMSSGTISLEACLQGIPGAIV
YRANPITYVVGRLLVAVDYLGIANILLDRPAWPEFIQGAARPRAIAKRMRECCEDEQVIN
QAQSDSKTLRSMLKNKSDCSVSDWLLRSLD

Enzyme Prediction     

No EC number prediction in MGYG000000973_00686.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	23	374	2e-90	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.09e-78	22	378	4	364	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.42e-76	23	374	5	363	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.55e-68	22	357	1	343	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.29e-58	22	379	8	375	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.87e-48	67	385	42	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATC65221.1	2.26e-136	1	389	1	382
AHF91230.1	3.73e-132	3	389	5	401
QYY34968.1	5.99e-132	14	385	4	379
QXD27119.1	2.09e-131	12	389	11	390
QXD23043.1	2.09e-131	12	389	11	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	8.25e-33	22	346	9	338	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.14e-32	22	346	9	338	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6J161	7.27e-60	22	346	6	330	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	7.27e-60	22	346	6	330	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J9H1	1.02e-59	22	346	6	330	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
A9NCA7	5.62e-59	22	346	6	330	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
Q83DS5	5.62e-59	22	346	6	330	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000973_00686.