CAZyme Information: MGYG000000964_01215

Basic Information

• Species: Phocaeicola salanitronis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola salanitronis
• CAZyme ID: MGYG000000964_01215
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797	MGYG000000964_21|CGC2	90533.34	5.0592

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000964	3100012	MAG	Denmark	Europe

• Gene Location: Start: 31667; End: 34060 Strand: +

Full Sequence      

MKEYILTVCCLLGVLAGIQAQDKLYPNTFGLNRVKLLEGPFKQACDLNVKTLKQYDTDRL
LAPYLKEAGLPSKAEGFSNWEGLDGHVGGHYLSALAIHYAATGDAECRQRMDYMVSELKR
CQEAHGNGYIGGVPDGERLWKEIQQGNVGLIWKYWVPWYNLHKTYAGLRDAWAYGGNEEA
RQMFLDLCDWGLTIIAPLSDEQMEQMLENEFGGMDEVYADAYEMTGDVKYLDAAKRFSHH
WLLDSMAAGIDNLDNKHANTQVPKVVGYQRIAELSARSGHTEDAALYRKASEFFWQTVVE
TRSLALGGNSRREHFAPAEDCLSYVYDREGPESCNTNNMLKLTEGLFRLNPEARYADYYE
RAVLNHILSTQHPEHGGYVYFTPARPAHYRVYSAPNSAMWCCVGTGMENHGKYGELIYTH
TENELYVNLFIASELDWAERGVRIIQETKFPDEESVRLTIRTEKPMKFKLLIRHPHWCRT
GAMQAVLNGQDYAAASVSSSYIEIERIWKDGDKVQLELPMSVSVEELPNVPQYIAILRGP
VLLGARMGTEGLDGLVAGDDRWGHIAHGPLVSLFNTPVLVGKRDEIIAKLEQMQPVSGKP
LCYTVPGLFEEKYASLVLEPFFRLHDCRYMMYWLSMTPEEYADYRQTVEETEQRKLLLDR
RTVDAVAPGEQQPEADHLMKQENSSTGYFENEAWRDARDGGYFEYTLNTGGLKELTLLVR
YWGNETTDPARAFDILVDGEVLVEENISGRWNRQEHVDVEYPLPATMTDGKETITVTFRS
RTGTVAGGIFNVRILKK

Enzyme Prediction     

No EC number prediction in MGYG000000964_01215.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	34	543	5.7e-201	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.58e-177	34	543	2	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	9.91e-113	31	548	9	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	5.77e-42	548	633	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37333.1	0.0	1	797	1	797
QCD36520.1	0.0	2	796	4	786
QUT88913.1	0.0	17	795	17	796
ALJ60078.1	0.0	1	795	1	796
QDO68314.1	0.0	17	795	17	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.33e-226	19	796	18	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.13e-219	19	796	18	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	4.78e-22	268	542	273	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.80e-20	268	542	273	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.44e-16	332	542	381	605	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000191	0.999239	0.000142	0.000144	0.000135	0.000123

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000964_01215.