CAZyme Information: MGYG000000956_01871

Basic Information

• Species: Barnesiella sp900538705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp900538705
• CAZyme ID: MGYG000000956_01871
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000000956_7|CGC2	45768.06	6.063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000956	2507716	MAG	Denmark	Europe

• Gene Location: Start: 64505; End: 65704 Strand: -

Full Sequence      

MAVSFLAATSFLCCPMPAVAQSDASASWAVRMVESEMARNPEAWQLDFQPKLKWDYCHGL
ELRAFLYVAEKYSRTDIRDYAISYADTMVNADGTIKKYKLTDYSLDRINSGKYLFEVYDL
TGEARYKKALDLLRSQFEKQPRNDDGGFWHKKVYPHQVWLDGVYMGSPFLAEYAYRYESE
PLRSADYADVILQIVMAAHHTYDYESRLYKHACDVSRQMFWCDPVTGQSKHCWGRALGWY
AMAIVDNLEFIPADFEGRKQVVDILLHIASQLERYADPETGLWYQVMDRSGEPGNYLESS
ASCMFTYALYKGVRLGVLPEKYLTVANKAWQGILDRFIKVDDKGLVNITEVCAVAGLGGK
EKRSGDYEYYIHEKKRDNDAKAVGPFILTALEVERLQGK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	46	395	1.4e-110	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	5.30e-104	28	397	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.60e-88	48	396	28	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT73498.1	2.03e-182	4	397	8	398
CBK68198.1	4.49e-182	21	397	9	381
SCV08369.1	8.23e-182	21	397	26	398
QUR41787.1	8.23e-182	21	397	26	398
QRQ55761.1	8.23e-182	21	397	26	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	5.18e-97	54	396	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.52e-71	47	396	32	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.89e-70	47	396	22	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4CE7_A	1.12e-09	159	333	154	323	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.48e-70	47	396	32	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.06e-35	165	392	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.06e-35	165	392	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
L7P9J4	6.31e-09	159	333	161	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003280	0.676381	0.318975	0.000616	0.000400	0.000322

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000956_01871.