CAZyme Information: MGYG000000953_01265

Basic Information

• Species: Fusobacterium_A sp900549465
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A sp900549465
• CAZyme ID: MGYG000000953_01265
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219	MGYG000000953_67|CGC1	25573.96	6.2861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000953	1995240	MAG	Spain	Europe

• Gene Location: Start: 56; End: 715 Strand: +

Full Sequence      

MVIFPWEVEFYKKHGVDAIYFGNPFVDKYIVEKREEEYILLLPGSRKQEIKTLLPIMLEL
VKESKESKFLLKLSSEEHLKWISENLCEYPNLYLEFEKKLPECVKNSKVAIAASGTVTLE
LALMGLPTIVIYKTGFINAFIARHILKIGFVSLPNLTLDREVFPELLQERCNVEEIKKYL
IKLDKERERIDRDIQEVRDKLSGKNVVESYGDFLVKGER

Enzyme Prediction     

No EC number prediction in MGYG000000953_01265.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	198	2.3e-56	0.6016949152542372

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	6.64e-57	1	216	141	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	8.66e-49	2	203	140	361	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.13e-34	1	196	138	353	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	5.06e-28	3	187	134	320	lipid-A-disaccharide synthase.
PRK01021	lpxB	3.24e-11	1	202	366	590	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ19865.1	1.69e-128	1	219	139	357
SQJ09670.1	6.66e-104	1	219	139	357
AVQ26961.1	6.66e-104	1	219	139	357
VEH39859.1	9.44e-104	1	219	139	357
AVQ31390.1	9.44e-104	1	219	139	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.00e-11	1	183	144	344	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	7.33e-11	1	183	144	344	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6ALW0	1.01e-24	2	176	148	342	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q57310	5.37e-23	1	208	146	376	Lipid-A-disaccharide synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=lpxB PE=3 SV=1
B7KFS1	9.28e-23	1	201	146	367	Lipid-A-disaccharide synthase OS=Gloeothece citriformis (strain PCC 7424) OX=65393 GN=lpxB PE=3 SV=1
C0QR27	1.22e-22	1	214	134	373	Lipid-A-disaccharide synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) OX=123214 GN=lpxB PE=3 SV=1
Q2LVL8	2.30e-21	2	201	142	361	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000953_01265.