CAZyme Information: MGYG000000922_01724

Basic Information

• Species: UMGS416 sp900542005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UMGS416; UMGS416; UMGS416 sp900542005
• CAZyme ID: MGYG000000922_01724
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775	MGYG000000922_23|CGC1	87465.1	5.2256

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000922	2901170	MAG	China	Asia

• Gene Location: Start: 13216; End: 15543 Strand: +

Full Sequence      

MNQQLEEMPFLFKDEWWIGCQEPKPLPGGGEACYFRLPFRLSAVPEEGAGLCITSAGRFR
LYVNGQPVICGPCKGDRWNHYVTEVELAPYLRTGDNVIAVHVVCWPSRDELRGVPGPVSV
IPARTGAALLAVGAIGEVELSTAKAPWQAKADEADVWEGAGAYDDEHTVIPYVIATQRVR
TGYLPEGWSLPGELGWKMAKRRWRVGMQPGGELVPLPLKMAPIPPMAEQRRAFARQMPNR
PDDLPAIALSEGKVEANRHAALHLDAGALTTAYLPIRVEGGAGAVITVTYAERYMPDDPE
GRMRDDWAHGRLPGGQQEIYELDGRSHVLENFWFRTFRYVRIEIQTAEQPLRFGIEGYRE
TAYPLAVRARMELPEPLDALWQASLRTLRLCMHETHEDCPYYEQLQYSLDTRLQLLFTYA
VSGDTRMARRVLWDFHCSQLPDGILQSRYPCDLPQIIPSFSLYFIFMLEEYYLQTGDEAI
LSRYRPTIDAVLDYFDRHIGALGLVEYLGYWDYCDWVTEWGKNFGVPNAALTGPCTCHNL
VYVQALQAAARMVELTGRPDVAGEYSRRAQQIQDRLMEHCYDKSRGLLREGPEMEEFCQH
DQALAVLTGMVTGLDARRMMVRTLEEPMLQCTYPWMFTLCRALEKAGLYDKTMALWTPYL
KAMEYHMTTLPETPEPTRSDCHAWSSLPLYEFTRCWLGVRAGAPGWRTIEVTPQGCGLPS
LSGTVPTPQGDVRVAWQVKDGVWSLRASAPAVPVQVRLPDGTEGFFPRGGEIILP

Enzyme Prediction     

No EC number prediction in MGYG000000922_01724.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	260	751	1.4e-102	0.9702380952380952
CBM67	17	201	2e-18	0.9318181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.48e-22	377	684	13	328	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.03e-09	698	764	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	6.95e-05	461	576	341	457	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam04685	DUF608	8.64e-04	464	574	104	204	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS28317.1	1.09e-194	14	772	9	791
AIQ70316.1	7.94e-174	139	771	4	646
QTH40607.1	6.27e-161	29	762	24	761
AZN43562.1	6.94e-159	27	771	23	809
QNK56541.1	7.30e-157	1	771	1	794

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	7.37e-48	229	764	408	947	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	6.30e-17	326	734	264	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000922_01724.