CAZyme Information: MGYG000000921_00745

Basic Information

• Species: Dysosmobacter sp900546705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp900546705
• CAZyme ID: MGYG000000921_00745
• CAZy Family: SLH
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561	MGYG000000921_10|CGC2	61555.43	4.2037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000921	2037614	MAG	China	Asia

• Gene Location: Start: 44957; End: 46642 Strand: +

Full Sequence      

MYKRRFFASLTALALAAGLAMTPANAAFTDTQGHWAQEAITKWSEEYGLITGYEDGTFRP
DNSITRGAFAGILDRFLKYTAVSPASTFSDTAGTYWETSILKLHAAGVYLGTDGAALPGN
SITRQQAVTMIARAFGITGTSTSLPYADAGQIASYAKSPVAEMTARGYITDCADGNFRPT
DPITRAEIVNIMNNMVQVLIQNTQVYTGNIPGTVLINSAEGAYLSGMHITGDLILAPGVQ
DTVTLEDVTIDGTIRNFSSVTPTITSASDPDEDPDRPTDTEEPGNAEKPEEEKPGIRPQD
VYTPGKTTGEYIQYSGKSYPVYADAEPISLYDGDFYWEGDRLVYSGRDFRTRFGIDVSAY
QNRASQNQTIDWNAVANDGVEFAMVRVGLRGYSNGNLLSDAFYRQNIEGAMAAGLETGVY
FFAQAITVEEAIEEADFVISLLDGMEINGPVAYDWEMHDSTYRVYGTTPEMATACAVAFC
KRIEEAGYEAMVYAGQYVSYIKYDQGALAPYLYWYPEYKSASSQKLYPTFYYQMDYWQFS
SSCSIDGIGGKVDGNIQFIRR

Enzyme Prediction     

No EC number prediction in MGYG000000921_00745.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	355	548	1.2e-35	0.9943502824858758
SLH	28	67	2.1e-16	0.9285714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.12e-63	352	558	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.03e-25	354	556	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.48e-17	355	548	1	180	Glycosyl hydrolases family 25.
cd06415	GH25_Cpl1-like	5.19e-14	354	556	3	193	Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.
cd06522	GH25_AtlA-like	6.75e-14	355	558	4	192	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO37824.1	1.00e-289	1	558	1	556
BCK85948.1	3.82e-278	1	561	1	550
QCI60549.1	3.83e-277	1	561	1	546
BAK99312.1	4.76e-205	1	559	1	542
QNL45744.1	1.85e-197	14	561	12	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	7.57e-08	354	555	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.83e-07	354	555	22	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38537	1.91e-11	4	246	8	241	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1
Q06852	1.98e-10	45	197	2099	2265	Cell surface glycoprotein 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=olpB PE=3 SV=2
C6CRV0	2.41e-10	35	192	1291	1455	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P19424	1.11e-09	41	236	47	250	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
Q06853	2.21e-09	25	136	522	639	Cell surface glycoprotein 2 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=Cthe_3079 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000467	0.998216	0.000345	0.000494	0.000257	0.000194

TMHMM  Annotations     

start	end
7	29