CAZyme Information: MGYG000000919_00216

Basic Information

• Species: Niameybacter sp900551325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Niameybacter; Niameybacter sp900551325
• CAZyme ID: MGYG000000919_00216
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000000919_1|CGC2	44543.05	4.9588

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000919	4175004	MAG	China	Asia

• Gene Location: Start: 246523; End: 247656 Strand: -

Full Sequence      

MDLLQRYITQLIEESTPQHPIWNIEKIREGTKTKWNYIDGCMIKAILEMYHITKEDKYLE
FADSFIEYFVREDGTIQDYKIEDFNIDNINAGKTLFELYELTGKKKYRLAIDTLYEQIKL
QPRTKEGNFWHKAIYPNQIWLDGLYMAQPFYMEYETKFNKMCNYMDIYKQFLNVERLLKD
PNTGLYYHGYDSSREMFWCDKETGLSKNFWLRALGWFVMALVDTLEQMDEQIFYEYRKLM
SMFREVVEAMINYQDESGMWYQVVDQKDREGNYLETSGSAIMAYAILKGVRLEYLPEKLR
KYGEKAFYGVCNHALKEVDGKLQLEGICLVAGLGGKDRRDGSFGYYISEPVVANEAKGVA
PLLLAYTEMLRGDRLNG

Enzyme Prediction     

No EC number prediction in MGYG000000919_00216.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	29	371	9.9e-118	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.96e-100	31	371	30	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	6.34e-89	34	371	26	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH68585.1	1.93e-203	1	371	1	371
ADZ83101.1	1.93e-203	1	371	1	371
CBL09353.1	7.13e-188	1	371	1	372
CBL12002.1	1.01e-187	1	371	1	372
VCV21981.1	2.04e-187	1	371	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.14e-114	35	368	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.65e-64	34	369	38	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.96e-64	34	369	28	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	1.51e-15	35	371	65	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.21e-14	35	371	66	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	9.03e-64	34	369	38	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.94e-39	146	370	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.94e-39	146	370	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	1.20e-23	35	322	29	296	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000919_00216.