CAZyme Information: MGYG000000918_01510

Basic Information

• Species: Sutterella sp900545275
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella sp900545275
• CAZyme ID: MGYG000000918_01510
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000000918_10|CGC1	43489.54	8.2517

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000918	2489541	MAG	China	Asia

• Gene Location: Start: 45411; End: 46598 Strand: +

Full Sequence      

MIAKRSFLQALGAAALLSSPLARVAATTDGVRRTLSWSAWRRFAAEAVSAEGRLIDPSDA
RLITTSEGQSYGLFFALVDDDRELFERLRRWTVDNLCAGDAGKNLPAWLWGKTVVPAPKT
ADSRRAAEKPAPVVRWGVIDANNATDADLWIAYALLEAGRLWKEDAYREEGLALLDLVGR
TCLHETEAMGPVCLPGRTGFVDGEGRITFNPSYTPPQLLRRFAAEDPRWLAAERAALRAT
LRASPAGAAPDWAVFDESGTLVEDGRPFGSWDAVRVYLWAGMLPQDAPERDLLVRHFAPV
FRLVRARGSVPERIDTRTLAVSAAGPDAFGAAFLAWRPNSPEGDLLRARLEKLPIAAESY
YKSMLTLFGLGFDHARFAFDREGRLLRPIRSGVRS

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	37	372	2.3e-68	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	2.60e-126	21	386	9	365	cellulase.
COG3405	BcsZ	4.62e-74	36	379	25	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	1.05e-48	39	373	7	319	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53782.1	2.12e-104	37	388	71	410
APE99315.1	1.41e-102	36	386	25	362
ABY99087.1	1.41e-102	36	386	25	362
AVH39163.1	3.20e-101	37	386	26	362
QNT42998.1	6.41e-101	37	386	26	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2B_A	4.23e-100	36	386	3	340	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
7F81_A	3.20e-83	30	385	1	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXQ_A	3.61e-83	36	386	3	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F82_A	5.07e-82	30	385	1	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	7.18e-80	36	386	3	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L9	2.33e-84	31	386	19	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
Q8Z289	1.35e-83	27	386	16	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
Q8ZLB7	1.90e-83	27	386	16	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
P37651	3.69e-83	31	386	19	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	2.05e-77	37	391	33	377	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000005	0.000000	0.999993	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000918_01510.