CAZyme Information: MGYG000000918_01507

Basic Information

• Species: Sutterella sp900545275
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella sp900545275
• CAZyme ID: MGYG000000918_01507
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	MGYG000000918_10|CGC1	55338.51	9.5666

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000918	2489541	MAG	China	Asia

• Gene Location: Start: 40473; End: 41945 Strand: +

Full Sequence      

MLIRTVLLRFFRGVDREGAALLEKSTSLVSFIVNGALLAAAWLFLPLENANWRALRARFP
DVYPNVDPTRIRPLDGLRILIQSLFLLFFPGEGCASPTSVRRKKRSLPARLLYRATIALK
ARDRLGARRFAETAPRPFGPVRAISCVLLGTVAAVLFALCATQHLDPRFQVLFSACTFAL
ALVLRLVRIRLTVLLLVLLSLVVSSRYLWWRLTETVNFDSIGGHVFSAMLMSAEIYTFIL
MALSCFQTFWVLERKPCPPPEDRSLWPHVDVCIPSYNEPLELVRTTVLGVQSMDWPKEKL
HVWILDDGDRDDFEAFAKEAGAGYIRREEHKGAKAGNINHALGKIHGEFVVIFDCDHIPV
RSFLTQTMGWMLRDEKIALVQTPHHFYSPAPYQRNLRLTDAVPQEDALFHVFIQRGNDTW
NATLFCGSCTVIRRKALDEIGGIATETVTEDAHTSLRLYRRGWRSAFLSTPLAAGLSTET
LASHIGQRIR

Enzyme Prediction     

EC	2.4.1.12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	270	441	9.6e-36	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11498	bcsA	5.80e-179	48	490	38	483	cellulose synthase catalytic subunit; Provisional
TIGR03030	CelA	5.22e-150	137	490	2	372	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
cd06421	CESA_CelA_like	1.15e-112	267	490	1	225	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	1.09e-49	226	490	12	279	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.21e-29	273	451	3	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ96025.1	1.34e-156	30	490	30	509
ANU67170.1	1.34e-156	30	490	30	509
QDA53780.1	1.06e-152	147	490	63	406
QQS88758.1	6.48e-146	23	490	22	504
QDA53875.1	2.16e-144	12	490	10	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	6.63e-138	11	490	21	496	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	5.33e-65	206	490	67	370	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.49e-64	206	490	79	382	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.51e-64	206	490	80	383	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37653	2.55e-137	11	490	21	496	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q8X5L7	5.57e-136	11	490	21	496	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
Q93IN2	5.50e-133	11	490	21	496	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	1.09e-132	11	490	21	496	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
P58932	1.60e-118	128	490	14	376	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000005	0.000050	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
25	47
138	160
170	187
192	209
224	246