CAZyme Information: MGYG000000906_00531

Basic Information

• Species: Phocaeicola sp900552075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552075
• CAZyme ID: MGYG000000906_00531
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
905	MGYG000000906_2|CGC7	103306.85	7.9397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000906	2359165	MAG	China	Asia

• Gene Location: Start: 186812; End: 189529 Strand: +

Full Sequence      

MNKINQFLIACAWLVFPIGGQAQQNDSYFVKHLKFFGNESLEQKASMAARLVPSPQQLAW
QQMELTAFLHFGINTFTGREWGDGTEDPSLFNPTELDADQWVRTLKKCGFKMVLLTAKHH
DGFCLWPTKTTSHSVASSPWRNGKGDVVRELRDACTKYGMKFGVYLSPWDRNAPCYGNSP
EYNKFFIEQLTELLTNYGEVNEVWFDGANGEGPNGKKQVYDWDAFYKTIQRLQPKAVMAI
MGDDVRWVGNEKGIGRETEWSATVLTPGIYARSAENNKRLGVYGKAKDLGSRKMLKDATE
LFWYPSEVDVSIRPGWFWHEEENAKVKSLKELSDIYFQSVGYNSVLLLNVPPDRRGLLNE
ADVTRLKEFAVYRRQVFSDDKVQDGNVSWTACAGECRSYSVRLNSPLNVVQIQEDISKGQ
RVEKFTVEAYRDGRWQSLSEGTTIGYKRMLRFPELTADSIRVRIDSCRLCANISNVSAYY
APALTSQTRIADWNTLPRSTWKQLSSSPLVLDLGKPIRLKAFTYAPLNGEAKPTMAYRYK
LYVSENGRDWQKLISQGEFSNIMHNPLPQTIALPVVTTARYVKLEAVTPDDNPAIVEMEE
FGVTVVDDKDDETKVYPHPDEVLKLKPGDEHPTQKGWYFYTAHEFLDKHTKKGLPLGFQE
HKTQTMSKSACVNNAKCSKVENGVLHMWPVEESDSIDNGFGKFVKYSHAAYRSVRSGKEA
WCNFTENMRIEIRFKRIAAEGFNEALWFMGNKGPWPKNGEIDLLENPKKKINQRAHFTLH
SEHHYAGVVGGEGSVTSSIALADMSQWNIYWLEWYPDKIVGGVNGKKFFEHKKGSNGNMD
WPWSDPAGFYLIFSTGLSVDPNAWPGSVNPQKWDKQNPPSMYIDWVRVYVNDDYNRDKAP
KARYY

Enzyme Prediction     

No EC number prediction in MGYG000000906_00531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	53	372	1e-81	0.861271676300578
GH16	663	889	1.3e-28	0.8739130434782608

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	3.59e-72	53	479	11	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	3.12e-35	89	368	77	323	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	4.61e-31	90	369	75	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
cd08023	GH16_laminarinase_like	2.21e-27	678	889	40	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	3.99e-12	729	889	69	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ17909.1	0.0	28	905	23	925
QUT75447.1	0.0	12	605	2	595
QRP58722.1	0.0	1	605	1	603
QQT79395.1	0.0	1	605	1	603
ASM67352.1	0.0	1	605	1	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	7.32e-316	23	606	2	585	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	8.13e-132	49	478	15	475	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	7.33e-130	49	478	17	477	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	9.66e-130	49	478	15	475	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
5K9H_A	1.23e-123	52	586	38	567	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	3.98e-113	35	496	11	497	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.74e-110	52	468	39	465	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P49713	1.32e-11	78	207	82	211	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
Q9ZG90	3.23e-11	729	889	136	287	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P10901	1.43e-09	89	207	98	223	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.998993	0.000214	0.000162	0.000151	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000906_00531.