CAZyme Information: MGYG000000906_00323

Basic Information

• Species: Phocaeicola sp900552075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552075
• CAZyme ID: MGYG000000906_00323
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686	MGYG000000906_1|CGC3	78036.62	5.1605

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000906	2359165	MAG	China	Asia

• Gene Location: Start: 397457; End: 399517 Strand: -

Full Sequence      

MKSLLFLYFFVAMAFSAVATSVSESYVIPYPQQMVVGEGHFVFQKNASFSCNLKGADKED
FVKYVGQSPFAWTYKKRGKTDIVFKLLSPKQSQMKEEAYRLEVTKKGIQVEATSTSGLFY
AFQSINQLIQPAGNNTFLLPEVTIEDAPRFAYRGMHLDVSRHFYTKEFVKKQLDALARYK
LNRFHWHLTDGAGWRIEIKKYPELTRETAYRPFPDWKSWWNGGRTYCRQDAPGASGGYYT
QEDVKEIVEYARQLHITVIPEIEMPAHSEEVLAALPQLACGGDLKPGGEFCPGKELTYTF
LTDVLKEVMALFPSEYIHIGGDEASTNHWKQCPDCQAWMKEEGMKEEGELQEYLVSRIEK
FLRENGRKMIGWDEILTGELDETSAVTVWRGEDKGAESVKRGLRTILSPGAYCYFDSYQD
APRTQPEAIGGYLPLEKVYSYEPVTPAFPADKLDCVWGVQGNVWTEYLSTPEHTEYMIYP
RLLALAEVAWTNPERKDWKRFHAEALQEVEVLDSLGYHTFDLKNEVGNRLEALSVDNHLA
KGKKVEYLRPYAADYYPAGGDGALTNGIHGGWVYTDLRWQGFLGKGMDAVVDLEKSQPIR
QLSIDFMQLIGPGVFLPQKVSFLVSDDGKEYTLLKTITTTLPITDEKLTIQNYAWEGTCE
ARYVRVQADINPEAGGFLFTDEIVVK

Enzyme Prediction     

No EC number prediction in MGYG000000906_00323.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	145	492	8.1e-120	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	0.0	150	501	1	353	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	2.07e-151	150	492	1	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	2.61e-112	69	535	183	658	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	7.66e-104	150	501	1	325	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06570	GH20_chitobiase-like_1	2.60e-82	150	497	1	303	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM57238.1	1.03e-315	14	685	3	672
AVM52249.1	2.47e-312	6	686	4	685
QUT77208.1	3.66e-273	24	686	26	689
CAH07512.1	2.06e-255	27	686	29	690
QCT78330.1	2.06e-255	27	686	29	690

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	4.60e-131	18	686	38	774	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7CBN_A	1.01e-95	77	516	62	507	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
7DUP_A	1.07e-87	29	518	8	519	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
6EZR_A	1.41e-87	28	516	143	634	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
7DVB_A	5.78e-87	29	518	8	519	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	1.72e-114	94	501	108	514	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	7.52e-95	77	516	81	526	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	7.51e-88	19	486	133	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
Q7WUL4	8.97e-65	96	517	81	475	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1
B2UP57	4.23e-60	77	528	37	483	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000231	0.999176	0.000139	0.000148	0.000127	0.000129

TMHMM  Annotations     

start	end
5	27