CAZyme Information: MGYG000000892_01959

Basic Information

• Species: CAG-115 sp002492075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp002492075
• CAZyme ID: MGYG000000892_01959
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598	MGYG000000892_190|CGC1	68791.79	5.647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000892	2629881	MAG	Denmark	Europe

• Gene Location: Start: 1766; End: 3562 Strand: +

Full Sequence      

MFKFKQTDPRSARLLPGLFRERAEINRAYLMELKTENLLQNFHLEAAIRTDRDIEDMHLG
WESPVCQLRGHFLGHWLSAVSMLIATESDRELKAKHDIVIEELQKCQKRNGGRWIGSIPE
KYFEMLENNEYIWSPQYTLHKTLLGLYHSALYAENKTALVILDGAADWYLEWTAKTEEKN
PHAIYSGEEGGMLEVWAGLYQLTGEKKYLTLALRYSKPSIFERFENGEDPLSDCHANASI
PWAHGAAKMYEITGEERWLKLVKSFWDCAVEKRESFCTGGQNSGEFWIAPGRLGSFLEER
TQEFCTVYNMVRLADYLLRFTGDKKYGDYIEKNLYNGFLAQQNKFTGMPAYFLPLKAGSR
KKWGSKTHDFWCCHGTMVQAQTIYPMLCQYEDEERNRTVISQYINCEYKRSENVTVTQSA
DMKYYGGGAFFDEHDESSMSRWSIKITVTAKSPEKFTLSLRIPDWVNGEPSVMVNGEKTE
LVVKDGYIDIERVWSADTVSVYFHVSVSVSRLPDAPRLTAFSEGPIVLAGLCGSDRGIRV
SDPERPEKALVNVTQHTYGTFPWQQSVYRTADQDGNFELIPLYDVADETYTVYFTVHS

Enzyme Prediction     

No EC number prediction in MGYG000000892_01959.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	13	529	2.9e-154	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.33e-99	13	529	3	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.35e-69	26	535	26	507	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	3.47e-04	184	334	408	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04791	LanC_SerThrkinase	0.007	157	261	52	167	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17727.1	0.0	14	598	12	595
ADL50077.1	3.82e-249	5	594	3	600
QTE68365.1	3.76e-221	11	598	9	603
QUA54004.1	9.64e-217	10	595	8	601
ADU23130.1	1.47e-215	11	595	9	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.13e-56	13	594	34	648	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.32e-53	13	594	34	648	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	1.83e-17	76	527	82	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	9.83e-17	76	527	82	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	9.21e-16	199	527	202	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	4.98e-11	76	527	81	564	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000892_01959.