CAZyme Information: MGYG000000870_01113

Basic Information

• Species: Akkermansia sp004167605
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp004167605
• CAZyme ID: MGYG000000870_01113
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
953	MGYG000000870_5|CGC2	104504.17	9.2213

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000870	3134704	MAG	United States	North America

• Gene Location: Start: 122123; End: 124984 Strand: -

Full Sequence      

MNGFQLLQCGFGVAALLAGPVMGAPAVYPVPQQSKLSSQTAAFSGKPSVVVRSARTQGDK
LLAGVPEKSGAYKLVVSPQGKVGIGAHDERGAFYAMQTLRQLGKKTGNGDAVMLPVGEIT
DWPDIEFRGTVEGFYGTPWSHEARLSQLRFYGQNKMNTYIYGPKDDPYHSSPHWRDPYPA
DQAAQIKELVKVARENHVDFVWAIHPGKDIKWTEEDMNNVIKKFEMMYKLGVRSFALFFD
DIFGEGTKADKQALLLNKINNEFVKVKKDVTPLVMCPTQYNRGWADDKPGTYLDILGEQL
DPSVHIMWTGNSVCHDITLEGQEWVNKRIKRPSYVWWNFPVTDYCRSNLCMGRVYGLPQE
PGSRESMSGLVSNPMDKPEASKVTLFGIADYAWNINGFKSDEAWKEGIVRLYPQAAEAMQ
AFVDHNSDQGPNGHGYRREESVNIATVVNRVLEAAREGKVVKSDTALLKKEFSRMAAAAP
VIREKVDNPRLMKEIGAWVDAFEQLGMAGQHAVAALESSNPKAAVTNLVKATQTLAAMDR
ISQQHNQQGQLYRSAVKTGSRVMTPAVNELADIVSRKTFPSLSGTPALSPKPLVKGGSMD
KAELFCDGDRGTFWHSGAYGQPGDWYGVDYGMAIPVRSVEVLMGRNDKDGDYVAKGQLEA
TQDMKTWKPLGPETSGMQVAWQAPKPVSVRAVRYRVIEPKKTDNGRGVWTAIREISVNAP
AAARASSNVAGLEGVSVQKSDKIVRISRVMETHKMKPGEFIALDLEGPTDATWLEINLER
DDVNSWAEVVLDVEGAAKPVVQKLDRQGQNFIAKANQLPKGIKGMKLVNKSGKEQDVVLN
MFKFDVPPADPGANLAALSDRNLKTVYRADKPLDVVIPNLDNPRATKLVVVGSAAYAVQA
RRGEGAWTSVGKKAAGAGAAEFAIPAGTTAVRLFYNAPQKDAVINEVIFSSKK

Enzyme Prediction     

No EC number prediction in MGYG000000870_01113.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	128	423	2.7e-112	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	3.53e-165	128	422	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam00754	F5_F8_type_C	1.06e-09	607	715	19	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam02838	Glyco_hydro_20b	2.55e-08	24	121	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	6.60e-05	64	129	200	265	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd00057	FA58C	0.001	607	670	30	92	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP70109.1	0.0	1	953	1	953
QWO92769.1	0.0	1	953	1	953
QWO95299.1	0.0	1	953	1	953
QWO85461.1	0.0	1	953	1	953
QWP26869.1	0.0	1	953	1	953

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CHO_A	5.52e-165	65	670	74	671	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	1.06e-164	65	670	73	670	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	1.09e-164	65	670	74	671	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2JIW_A	1.09e-164	65	670	74	671	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	1.20e-164	65	670	77	674	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	1.14e-163	65	670	95	692	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	6.53e-94	68	616	129	659	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	2.37e-93	68	616	129	659	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	1.21e-52	74	718	135	795	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	3.50e-37	129	401	63	342	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000386	0.998916	0.000192	0.000169	0.000156	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000870_01113.