CAZyme Information: MGYG000000861_00563

Basic Information

• Species: Olsenella_B sp900548775
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B; Olsenella_B sp900548775
• CAZyme ID: MGYG000000861_00563
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	MGYG000000861_6|CGC1	92098.36	4.7842

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000861	2145101	MAG	China	Asia

• Gene Location: Start: 63403; End: 65838 Strand: +

Full Sequence      

MNINSLGICRHVEKIYQLVSIDGIPEDALLDITAQDDKGNNVPAKVFRDTPTEAVVVLID
EHSGASTVTYTLFASDGPITDRDAWREVGSATMSFNDAKWQSRVNYRMHRDLTARIRDYD
LGHAFLFSTIFIKKAIPDRGRAIVRVAVRVPWREDGEIAIRICDQSLNIIDPAPTLMGSQ
QFDSRFSGTVKYRETVFSAVLPRDDRTVIFDACDKADPHQHTFFELAKPDLDSLIHDTEV
LTMSADRDPYYNEWFQGQRVQPWELRLQSEVRFDNEVTWSVVVPLFHTTHEQFEDLVTGF
VDQSYSHWELILVNASPEDEGLASQVADAVASDARIRCVTLEKNLGITLNTAAGIRAATG
DFVGFVDHDDTIEPDLFFHYTEAVNTTPETDVLYCDEDKIDPTGRNVWPFLKPQLEIDLL
TCKNYICHMLAVRRSLLMRLEFDNPEYDGAQDHHLTLQVVEKARRVTHVPRVLYHWRMWK
TSTATNEGAKDYAQEAGMAAVRAHFQRIGVDAEVGEGERPFSYHVFHRPPAPHPRVSILI
PSRDHVELLERCVDSILSKSTYDNYQVVVIENNSEREETFSYYERVQRESQGRVRIASWK
GQGGFNYSGLINFGARESDGEYLLLLNNDMELRTSDWLERMLGLASRKDVGAVGARLLYP
DNTIQHAGVIVSGSCANHFGIDLPESDHGYCNLIECEQDLSAVTGACLMVSRALFEEVGG
LDESLAVAFNDVDFCLKLREMGLLVVYTPQVALTHFESVSRGSDYSTSRVKRFAHEVGIM
RERWSDYYGLGDPYYSPLLRSYEPLDTYWSF

Enzyme Prediction     

No EC number prediction in MGYG000000861_00563.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	537	668	4.4e-17	0.7470588235294118
GT2	280	437	3.9e-16	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.12e-64	280	478	4	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.50e-38	538	757	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.62e-30	534	811	3	271	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG1215	BcsA	1.30e-16	528	811	48	321	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd00761	Glyco_tranf_GTA_type	7.39e-16	538	747	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY61387.1	3.22e-237	1	809	1	807
AZH69456.1	2.64e-234	1	809	16	821
ATP53720.1	2.41e-232	1	809	16	821
ACV56016.1	1.36e-229	49	809	38	792
ACV56006.1	2.45e-191	1	797	1	818

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.79e-101	257	799	345	888	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	8.13e-82	268	799	310	831	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71059	1.29e-09	280	477	6	212	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
D4GU63	2.36e-07	603	758	73	234	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
O32268	1.53e-06	280	375	9	102	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000861_00563.