CAZyme Information: MGYG000000853_01888

Basic Information

• Species: Prevotella sp900549175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900549175
• CAZyme ID: MGYG000000853_01888
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514	MGYG000000853_104|CGC1	57233.71	5.5197

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000853	3157276	MAG	China	Asia

• Gene Location: Start: 7863; End: 9407 Strand: -

Full Sequence      

MLAAVLFAAVHANAQETKVAPETDPSLTTLQLTVNTTRYQTVTGFGAAACFGAMEPIRDT
KVIDMLYGPDSKVGLNILRMEISPNLVGDVKEEWWDPIYDWNGYLPVTKRAKEYGAIVFG
TPWSPPAVYKTNNSASGGQVTNDDGSVGGERGKLKTENYKDFFPWLNTFLTYMSNNGVNV
DAVALQNEPDWWVGYSGCLYTPEELHELVLKYAKRLNKSKFGVKLISAESLNFTPSYSDA
LLDDPETAQHIEILGGHLYGNPPLNNMKTVATKGLNMGKETWMTEHSFDPRGEKTGADRV
IDLPTWHEELLFAEELNESMLANASAYIYWYMIAHWSFIGSGDATVQPGNDKGKLLRRGL
IMSHFAKHLPGATRLGYSSSAAERTNAPVEFSSYIKGDSLIVMAIDTLPRDYNLKMKLPY
KVKGGKRIQSTEDAVVAEATLDISEPTDELTFRFPGRSLSTYIFTIDNGTDAISTVETEE
QKVREDNAWYNMKGQRVDNPKNGVFIHRGKKILR

Enzyme Prediction     

No EC number prediction in MGYG000000853_01888.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	35	419	3.9e-98	0.9707602339181286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	6.93e-60	32	463	36	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam02055	Glyco_hydro_30	6.79e-08	67	306	31	295	Glycosyl hydrolase family 30 TIM-barrel domain.
pfam14587	Glyco_hydr_30_2	1.31e-07	36	330	9	353	O-Glycosyl hydrolase family 30.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29062.1	2.24e-180	29	513	23	499
ADY53099.1	1.22e-62	39	459	137	503
QBJ85789.1	8.36e-58	27	464	25	429
AGF57037.1	1.74e-57	33	463	37	413
AZB32181.1	2.15e-57	27	464	25	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CXP_A	1.00e-55	38	463	13	386	X-raycrystallographic protein structure of the glycoside hydrolase family 30 subfamily 8 xylanase, Xyn30A, from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
1NOF_A	4.91e-52	39	418	11	335	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]
4FMV_A	1.66e-39	40	463	14	385	CrystalStructure Analysis of a GH30 Endoxylanase from Clostridium papyrosolvens C71 [Ruminiclostridium papyrosolvens DSM 2782]
4CKQ_A	3.86e-38	70	452	63	408	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQ9_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQB_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQC_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQD_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQE_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
3GTN_A	8.70e-38	71	403	45	327	CrystalStructure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3GTN_B Crystal Structure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3KL0_A Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_B Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_C Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_D Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL3_A Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_B Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_C Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_D Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL5_A Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_B Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_C Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_D Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q45070	6.99e-37	71	403	76	358	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
Q6YK37	3.51e-36	71	463	77	420	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000510	0.998699	0.000184	0.000225	0.000184	0.000174

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000853_01888.