CAZyme Information: MGYG000000853_01277

Basic Information

• Species: Prevotella sp900549175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900549175
• CAZyme ID: MGYG000000853_01277
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MGYG000000853_55|CGC1	46926.36	6.6591

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000853	3157276	MAG	China	Asia

• Gene Location: Start: 9353; End: 10594 Strand: -

Full Sequence      

MVIVLLCSGLGTEARTYDGGRMYTSYKGLVMAGYQGWFNAPGDKAGRGWYHYTGKDGFRP
GSASVDMWPDVSEYENTYKSPFVYEDGSPAYLPSSYDSTTVDTHFRWMKEYGVDGVFMQR
FVSEIRGESGLHHFNTVLGNAMTAANKYERAICVMYDLSGMNAGEDSVVINDIRKLAREH
SLMEHEKNPSYLYHNGRPLVAVWGVGFFDSRKYGMTEAQRIVGALKDMGFSVMLGVPTHW
RLLGEDTNPDLRLHDLIRRCDIVMPWFVGRYTEATFDNYKPLIRADIEWSRKNGVDYAPL
CYPGFSWRNLSYPQEGTLFIPRNGGSFFWKQLSYALEAGAEMIYVAMFDEIDEGTAIFKC
ARRVPLPYPGSTFLPLEEGVRPEHYMQMVGRAGSALREQLGMKAEILQKKDKK

Enzyme Prediction     

No EC number prediction in MGYG000000853_01277.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	81	355	1.8e-24	0.978021978021978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11576	GH99_GH71_like_2	1.91e-177	24	399	1	378	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism. The domain may co-occur with other domains involved in the binding/processing of glycans.
cd11573	GH99_GH71_like	3.08e-38	91	392	5	282	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
cd11575	GH99_GH71_like_3	7.44e-09	29	357	8	307	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.
cd11578	GH99_GH71_like_1	2.70e-06	74	357	5	290	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.
cd11574	GH99	3.30e-06	34	374	5	319	Glycoside hydrolase family 99, an endo-alpha-1,2-mannosidase. This family of glycoside hydrolases 99 (following the CAZY nomenclature) includes endo-alpha-1,2-mannosidase (EC 3.2.1.130), which is an important membrane-associated eukaryotic enzyme involved in the maturation of N-linked glycans. Specifically, it cleaves mannoside linkages internal to N-linked glycan chains by hydrolyzing an alpha-1,2-mannosidic bond between a glucose-substituted mannose and the remainder of the chain. The biological function and significance of the soluble bacterial orthologs, which may have obtained the genes via horizontal transfer, is not clear.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT39634.1	4.46e-190	2	399	8	400
QUT72097.1	4.46e-190	2	399	8	400
ALJ40802.1	1.27e-189	2	399	8	400
QQA09893.1	1.27e-189	2	399	8	400
BCA51193.1	2.02e-189	18	399	4	382

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000314	0.999052	0.000154	0.000178	0.000154	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000853_01277.