CAZyme Information: MGYG000000840_01517

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000840_01517
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		31549.8	9.9479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000840	2579152	MAG	China	Asia

• Gene Location: Start: 4937; End: 5848 Strand: -

Full Sequence      

MNKQTLQMPIRSAFALDQARAALFAGAAAAALLSGCSSLEPAPVPIVDRSDYSEASSRAG
STTGTSLIRDSGRTHVVAPGDTLYNISVRYGLDSGELARLNAVSDPTQLRLGQVLHLPES
VREPRTPVVAGGVRVSRVTTGDTSQTSTASKPAEKTAETAAGSASVQTPDKTEAQAPVVV
PGTRMLWPARGNIIADYAKNGKGLDIGGTAGSVVVAAADGTVLFVGDGVKGYGNLVIVKH
SPTLVTAYGHNSKVVVKLNDKVKAGQKIAEMGSTDADQTMLRFEVRDKGKPVDPMKYLAP
KRQ

Enzyme Prediction     

No EC number prediction in MGYG000000840_01517.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10871	nlpD	3.63e-42	71	302	59	319	murein hydrolase activator NlpD.
COG0739	NlpD	2.90e-39	72	302	1	268	Murein DD-endopeptidase MepM and murein hydrolase activator NlpD, contain LysM domain [Cell wall/membrane/envelope biogenesis].
pfam01551	Peptidase_M23	3.69e-33	202	294	4	96	Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.
COG4942	EnvC	8.97e-26	153	294	257	414	Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning].
cd12797	M23_peptidase	9.40e-26	202	285	2	85	M23 family metallopeptidase, also known as beta-lytic metallopeptidase, and similar proteins. This model describes the metallopeptidase M23 family, which includes beta-lytic metallopeptidase and lysostaphin. Members of this family are zinc endopeptidases that lyse bacterial cell wall peptidoglycans; they cleave either the N-acylmuramoyl-Ala bond between the cell wall peptidoglycan and the cross-linking peptide (e.g. beta-lytic endopeptidase) or a bond within the cross-linking peptide (e.g. stapholysin, and lysostaphin). Beta-lytic metallopeptidase, formerly known as beta-lytic protease, has a preference for cleavage of Gly-X bonds and favors hydrophobic or apolar residues on either side. It inhibits growth of sensitive organisms and may potentially serve as an antimicrobial agent. Lysostaphin, produced by Staphylococcus genus, cleaves pentaglycine cross-bridges of cell wall peptidoglycan, acting as autolysins to maintain cell wall metabolism or as toxins and weapons against competing strains. Staphylolysin (also known as LasA) is implicated in a range of processes related to Pseudomonas virulence, including stimulating shedding of the ectodomain of cell surface heparan sulphate proteoglycan syndecan-1, and elastin degradation in connective tissue. Its active site is less constricted and contains a five-coordinate zinc ion with trigonal bipyramidal geometry and two metal-bound water molecules, possibly contributing to its activity against a wider range of substrates than those used by related lytic enzymes, consistent with its multiple roles in Pseudomonas virulence. The family includes members that do not appear to have the conserved zinc-binding site and might be lipoproteins lacking proteolytic activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF24071.1	2.44e-111	30	302	36	323
QDA55742.1	6.80e-107	16	303	4	295
QQS89964.1	1.13e-89	29	302	15	312
QSB19339.1	5.00e-53	23	298	18	294
AIS15976.1	1.53e-51	23	298	18	281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BH5_A	7.07e-16	181	299	17	141	LytMdomain of EnvC, an activator of cell wall amidases in Escherichia coli [Escherichia coli K-12],4BH5_B LytM domain of EnvC, an activator of cell wall amidases in Escherichia coli [Escherichia coli K-12],4BH5_C LytM domain of EnvC, an activator of cell wall amidases in Escherichia coli [Escherichia coli K-12],4BH5_D LytM domain of EnvC, an activator of cell wall amidases in Escherichia coli [Escherichia coli K-12]
6TPI_A	1.82e-14	181	299	261	385	EnvCbound to the FtsX periplasmic domain [Escherichia coli K-12]
6UE4_A	2.70e-07	188	300	253	365	ShyAEndopeptidase from Vibrio cholerae (Closed form) [Vibrio cholerae O1 biovar El Tor str. N16961],6UE4_B ShyA Endopeptidase from Vibrio cholerae (Closed form) [Vibrio cholerae O1 biovar El Tor str. N16961]
6U2A_A	2.72e-07	188	300	250	362	ShyAendopeptidase from Vibrio cholera (open form) [Vibrio cholerae]
2GU1_A	3.33e-07	188	300	219	331	Crystalstructure of a zinc containing peptidase from vibrio cholerae [Vibrio cholerae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45682	5.48e-46	23	298	25	294	Lipoprotein NlpD/LppB homolog OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA3623 PE=3 SV=1
Q46798	3.00e-39	61	300	32	244	Uncharacterized lipoprotein YgeR OS=Escherichia coli (strain K12) OX=83333 GN=ygeR PE=3 SV=2
P44833	2.52e-36	72	298	144	402	Outer membrane antigenic lipoprotein B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=lppB PE=3 SV=1
Q56131	2.74e-36	60	298	109	370	Murein hydrolase activator NlpD OS=Salmonella typhi OX=90370 GN=nlpD PE=3 SV=2
P40827	2.96e-36	60	298	113	374	Murein hydrolase activator NlpD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=nlpD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000463	0.042291	0.957125	0.000064	0.000070	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000840_01517.