CAZyme Information: MGYG000000833_00895

Basic Information

• Species: Collinsella sp003436275
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp003436275
• CAZyme ID: MGYG000000833_00895
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	MGYG000000833_6|CGC3	49105.22	4.5671

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000833	2326911	MAG	China	Asia

• Gene Location: Start: 72157; End: 73470 Strand: +

Full Sequence      

MSLGKLTVNTREDGFLCDGKPFFWFADTCWSAFTSITEDDWDYYLTRRAEQGMNVLQVNT
LPQWDRCLPDLGIWPYASEDGVHFDWSAPNQEYWDRARRMCQAAVEHGIRPALVLMWCNY
VPGTWGSVIAERLGAEVMPREEVRAHVARVVENLGEFDPVYVVTGDTDFAGDEAIAYYGD
VLDEVTKLAPESLHTMHINRGNRALPEQFADRLDFYMFQPGHNYSGQEEAWKLPEDFRAQ
YPKKPMVNSEPCYEQMGASRNVYWRFTAQDCRASVWSSILAGASAGITYGAHGVWNWQTS
QSRGSVLGEGFDMPFRWQECLQFAGVWDFGLIEHVLRGLGATSADGAVAVEPAQELLDDV
REAIRVARVGERVVVYLPRTTAVKLKLEGSTTAWNAVAFDLENKCVANLAVVPVDGAVRV
AQHPFEHDALLVVSPAQ

Enzyme Prediction     

No EC number prediction in MGYG000000833_00895.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	15	390	1.2e-88	0.8737864077669902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	5.04e-85	18	339	9	320	Protein of unknown function (DUF4038). A family of putative cellulases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH70520.1	3.46e-302	1	435	1	435
ATP54527.1	1.15e-284	1	437	1	437
QWT17210.1	6.80e-205	1	433	1	435
AEB07692.1	1.20e-201	1	435	1	456
QRT29801.1	2.40e-153	3	433	1	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	7.62e-19	2	294	14	309	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	2.75e-17	4	290	29	318	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]
3KZS_A	3.40e-17	2	294	14	309	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000833_00895.