CAZyme Information: MGYG000000830_01617

Basic Information

• Species: Collinsella sp002232035
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp002232035
• CAZyme ID: MGYG000000830_01617
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
743	MGYG000000830_45|CGC1	79506.43	4.3439

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000830	2260107	MAG	China	Asia

• Gene Location: Start: 8538; End: 10769 Strand: +

Full Sequence      

MDIKDMVERMTLEEKAEICSGGDFWSTRAFERLGIPSVMMTDGPSGLRKQGGAGDHLGLN
ESVPAVCFPSSAAVASSFDTGLARELGEELGEECQAEDVALLLGPGLNIKRSPLCGRNFE
YFSEDPVLAGEMGAALVQGMQSRGVGSCIKHFACNNQETGRMVSDSAVDERTLHEIYLAP
FEAVVKKARPWAVMCAYNKVNGTYCAENRQLLTDILRDEWGFDGMVVTDWGAVKNRALGI
RAGLDLEMPGGTDRGTKQIVAAIEEGSLSMDELDLAVENVLSFVDKATAGHRAVELDLER
GYHLAVKAAERSAVLLKNEGGALPIAEGARVAFIGEFASSPRYQGSGSSHVNSARRSAPL
DCAPEGVVYAQGYRAADDEGDPALVAEAVRAAREADVAVVFAGLPDRYESEGYDRTTLAM
PANQVELIDAVAAAQPRTVVVLMNGAPVTMPWAGDVTAILEMYLAGDGAGEAAVSLLYGR
ANPSGKLAETFPLKLEDNPSYLNFPGENDRTEYREGVFVGYRYYDAKGMEVLFPFGYGLS
YTTFAYSDLELGTDAFAEGEELSVALTVTNTGERAGEEVVQLYVAPPIGQRRRPVRELKR
FTKVALEPGESARVEFSLDARALSYYEPILHEFCAESGAYGIEVGASSRDIRLQGTVSFA
SSSAPSRAFTAYSTVGDVMAHPAGEKVFAPLLERMVQGMGEAAGSGDDAGAREMIGGIQL
SSLVGFGMLTEEQLGDLLARLNE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	30	249	1.9e-71	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	8.59e-98	3	652	38	758	beta-glucosidase BglX.
COG1472	BglX	2.05e-65	32	357	57	379	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.01e-56	6	619	56	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.35e-56	313	521	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.53e-35	32	282	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF23779.1	6.45e-276	1	742	1	746
AYQ73056.1	3.20e-273	2	742	4	754
AHF25574.1	1.29e-270	1	742	1	746
QZN77821.1	9.07e-270	2	742	4	755
AHF26358.1	8.47e-269	1	742	1	746

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	7.89e-255	1	742	3	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.80e-196	7	691	9	694	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	8.05e-135	3	658	4	712	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.24e-133	3	658	4	712	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.69e-121	2	651	5	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.32e-254	1	742	3	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	3.60e-194	7	691	9	703	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	1.44e-193	7	691	9	703	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
B8NDE2	3.05e-140	1	651	4	823	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
Q2U8Y5	4.66e-139	1	651	4	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995686	0.004319	0.000022	0.000006	0.000004	0.000007

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000830_01617.