CAZyme Information: MGYG000000815_02570

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_02570
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1034	MGYG000000815_6|CGC2	118921.75	6.2334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 237620; End: 240724 Strand: +

Full Sequence      

MRKTLSLSLLLLGGGALFAQQSVPNWENPEVFAVNKEATRATSVPYQNERQALKDNYSES
PYFQSLDGTWKFFWVPKPAEVPSGFYNESYDVSKWANMPVPGNWEFNGYGIPMYVNTGFG
FPKNPPFIDREDAPVGAYRHTFNIPSDWDGRRVYLHFEGGTNSMYVWINGQEVGYTENAK
SPAEFDITKYIRKGQNTLACEVHKFSDGTYIEDQDMWRLGGINRSVYLYSTAQTRILDYF
AHPDLDKSYKNGLFSIDLSLKNYATEAQNQKVEISIIDKAGKKVLSKSQNISIPSGDKTD
LKLNGTVSAPLKWTAETPNLYTLLITLKDNKGNIVESTSSKIGFRKIEIKDGQVFINGKK
IYFKGVNLHEFNTNTGQVVTRETMMRNLQLMKELNINAVRTSHYPQQPLWYKLCDEYGIY
LVDEANLESHGLGYGPDNVSNFPEWHATHMDRIQRLIERDKNHPSVIFWSLGNEASNGKA
FFDMYDWAKARDNSRPVQYEQAYQKDRNTDIICHMYPSWENMKRDAAKDLGRPYIMCEYA
HAMGNSMGNFQDYWDLMRTSKNMQGGFIWEWYNHGYKTKDEQGREYFAYGGDLKGYNKMN
DGNFCMDGVIAPDQTYMPHTHIVKKVYQNIMFKAKDLDNGIITVINDYKFTDLTDKNYTY
KWVLLKNGEKVAEQNFEATVPADTQKDVKLNLPAISFEAGTEYYLQVFAYNKEKTEFLPA
GFEVAKEEFAFAKNQFFAKKNYSGALNVEKTDDKIIIKSGSLNYEFSAKDGKSLMSVTND
GKRVFDELPRLNFWRAPTDNDFGDWSQYRLRLWDAAGHNLIYTYKGMQETADGTSISYLA
KLRGIEAQVEITYLVNKDGSLTTTAYYQALSDDLPEMMRFGMLMTLPKEYDNFTWYGRGP
WENYVDRHHDTFMGIWTGDVEEQAYPYFRPQETGNKTDVRWLTLKDKNNSGIRIDGLQPL
SVSATNNMPEDLDPGMTKKQQHSSDILPRKEVVLCVDLFQRGVAGLNSWGAAPLDQYRFF
GKEYTYSYTISIIK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	50	912	1.5e-220	0.976063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	26	1030	17	1024	beta-galactosidase.
PRK10340	ebgA	0.0	25	1033	3	1000	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	2.88e-154	57	907	4	800	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	1.65e-102	347	632	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	4.95e-93	758	1030	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK59150.1	0.0	1	1034	1	1034
QIK53692.1	0.0	1	1034	1	1034
SCD19775.1	0.0	1	1032	1	1032
SCD20019.1	0.0	13	1032	25	1043
ADQ78237.1	0.0	10	1034	5	1035

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	3.55e-251	26	1032	4	981	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.66e-251	26	1032	5	982	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	3.55e-218	24	1034	5	998	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	7.49e-217	20	1034	4	1002	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	5.38e-166	25	1026	15	1016	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	2.00e-250	26	1032	5	982	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	6.48e-238	24	1030	18	1031	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q6LL68	1.01e-190	25	1027	11	1022	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
Q9K9C6	9.84e-190	31	1017	15	997	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
Q7MG04	1.59e-189	25	1026	12	1022	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002338	0.995251	0.001624	0.000276	0.000253	0.000244

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_02570.