CAZyme Information: MGYG000000815_01348

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_01348
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289	MGYG000000815_2|CGC7	32397.18	6.7606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 345432; End: 346301 Strand: -

Full Sequence      

MKIKYLLPLLLLTSFYTEVSGVEKSKVKSYIDNDYTCPPNYEVKQDGVMYGEIKAISYYS
PLAGADRKANIILPPDYDKGKKYPVLYLLHGIGGNENEWLDGKPDEIISNLSAQGKAKEM
IIVIPNISVVLKGESPAEYMTPAHHKQFDNFLSEMKTVLLPYIEKNYPVLKGRDNRAVAG
LSMGGRSALHVGINMIDDFAYIGAFTPAPGVLNNLFTAETLTLPEVYRKTTLLMITKGSR
DDVVGDNPENYSSALSKNGVDHIYFVLQGGHWWDVWNPSLYNFARRIFQ

Enzyme Prediction     

No EC number prediction in MGYG000000815_01348.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	61	285	1.3e-43	0.9647577092511013

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	6.65e-34	50	289	66	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	4.66e-23	64	280	5	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	1.09e-14	74	287	45	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	4.33e-14	60	282	16	253	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG1506	DAP2	0.010	64	272	375	595	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL52399.1	7.36e-84	18	289	45	323
ADZ84563.1	9.28e-71	40	289	217	473
QEH70018.1	1.84e-70	40	289	217	473
ADZ47894.1	1.10e-60	36	288	9	270
QEH42336.1	8.58e-60	38	289	28	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CXU_A	4.01e-62	36	288	9	270	Structureof the CE1 ferulic acid esterase AmCE1/Fae1A, from the anaerobic fungi Anaeromyces mucronatus in the absence of substrate [Anaeromyces mucronatus],5CXX_A Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_B Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_C Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus]
1JJF_A	9.28e-56	36	285	14	255	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	2.61e-55	36	285	14	255	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	1.25e-34	42	289	120	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	2.18e-33	42	289	98	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	8.38e-52	6	285	10	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P31471	2.69e-29	20	289	110	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	2.69e-21	40	289	418	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	5.15e-18	41	289	489	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P51584	1.56e-12	67	289	841	1076	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000628	0.996778	0.002031	0.000194	0.000178	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_01348.