CAZyme Information: MGYG000000815_00559

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_00559
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
563	MGYG000000815_1|CGC8	62366.07	7.7599

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 730104; End: 731795 Strand: +

Full Sequence      

MKKIVIASTAFLALALTNTVSAQYPKITPEVKKQETELIKAAYARSDSAFAIAKPIIDQQ
AKEGRPYIPWAARPTDLPQAEIPAFPGAEGGGAYSFGGRGGKVITVTSLADSGPGSLRDA
CEQGGARIIVFNVAGIIHLKSPLIIRAPYITIAGQTAPGDGVCIAGETIWANTHDVVVRH
MRFRRGETWVGRRDDSFGGNPVGNIMIDHCSTSWGLDENISFYRHMFNPEDGSKDLKLPT
VNVTIQNTISSQALDTYNHSFGSTLGGENCTFMRNLWANNAGRNPSIGWNGVFNFVNNVI
YNWVHRSVDGGDYTALYNIINNYYKPGPLTPKNTPVGHRILKPEAGRSKLGYFVFGRVYA
NGNVVEGYPEISKNNWAGGIQVQEQANTDGYTENMKWDKPFPIDNPFPIMSANEAYNFVM
DNVGATFPKRDIVDQRVIEQVKTGKVYYDKNLNPEDFYQFEYRRLPKDSYKSGIITDIKQ
VGGYPEYKGKPYKDSDNDGIPDAWEIKYGLNPNDPSDANGDLSGDGYTNIEKYINGIDPT
KKVNWKDPKNNYDTLAKRKSLMN

Enzyme Prediction     

No EC number prediction in MGYG000000815_00559.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	134	324	5.1e-66	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	9.95e-07	128	303	3	166	Amb_all domain.
pfam18884	TSP3_bac	3.00e-04	494	515	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
pfam03495	Binary_toxB	0.009	494	548	2	75	Clostridial binary toxin B/anthrax toxin PA Ca-binding domain. This domain is a calcium binding domain in the anthrax toxin protective antigen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK61104.1	0.0	1	561	1	563
QIK55695.1	0.0	1	561	1	563
ALJ01634.1	2.02e-308	1	558	1	557
QNL37620.1	5.30e-307	1	562	1	579
QUT77855.1	7.54e-306	2	562	4	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	2.73e-06	89	303	46	251	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CLG7	5.97e-53	84	540	22	416	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
B8NQQ7	1.16e-51	84	540	22	416	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
B0XMA2	4.44e-51	84	540	23	417	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	6.17e-51	84	540	23	417	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
Q2UB83	8.36e-50	84	540	22	416	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.998953	0.000195	0.000200	0.000185	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_00559.