CAZyme Information: MGYG000000788_01383

Basic Information

• Species: Bacteroides pyogenes
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides pyogenes
• CAZyme ID: MGYG000000788_01383
• CAZy Family: CBM50
• CAZyme Description: Integration host factor subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000000788_27|CGC2	40991.13	4.4854

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000788	2895183	MAG	China	Asia

• Gene Location: Start: 26020; End: 27096 Strand: +

Full Sequence      

MNERLTIQDFTDLLASKHNMTKKDAEDFVKEFFLLIEQALENEKYIKIKGLGTFKLINVD
SRESINVNTGERFKIQGHSKISFTPDTNLKEVINKPFAHFETVVLNENTLLEDTPTDEIA
AEEEDTEEEEEENLADIENYPKEEQVNTENLVTETIPAEEDNHKEMKKEEFAKNEDKTDE
CTKLESLSKSDTHQQRKSYIYYLTVGIVAILLLCGGVVFFVYYPDIFPPSPRKESIDLPI
NAGSAPLPEQITDTVAKKDTILEVAQELKDEVRHRQTVESKEQANPVNVYSESVVYQITG
TKTRYTIQKGETLTKVSLRFFGTKAMWPYIVKHNSDVIKDPDNVPFGTTIKIPELIEK

Enzyme Prediction     

No EC number prediction in MGYG000000788_01383.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00216	Bac_DNA_binding	8.58e-20	6	93	1	88	Bacterial DNA-binding protein.
smart00411	BHL	8.24e-14	5	94	1	90	bacterial (prokaryotic) histone like domain.
cd13831	HU	4.17e-13	8	91	3	86	histone-like DNA-binding protein HU. This subfamily includes HU and HU-like domains. HU is a conserved nucleoid-associated protein (NAP) which binds non-specifically to duplex DNA with a particular preference for targeting nicked and bent DNA. It is highly basic and contributes to chromosomal compaction and maintenance of negative supercoiling, thus often referred to as histone-like protein. HU can induce DNA bends, condense DNA in a fiber and also interact with single stranded DNA. It contains two homologous subunits, alpha and beta, typically forming homodimers (alpha-alpha and beta-beta), except in E. coli and other enterobacteria, which form heterodimers (alpha-beta). In E. coli, HU binds uniformly to the chromosome, with a preference for damaged or distorted DNA structures and can introduce negative supercoils into closed circular DNA in the presence of topoisomerase I. Anabaena HU (AHU) shows preference for A/T-rich region in the center of its DNA binding site.
cd13832	IHF	7.07e-13	9	91	3	85	Integration host factor (IHF) and similar proteins. This subfamily includes integration host factor (IHF) and IHF-like domains. IHF is a nucleoid-associated protein (NAP) that binds and sharply bends many DNA targets in a sequence specific manner. It is a heterodimeric protein composed of two highly homologous subunits IHFA (IHF-alpha) and IHFB (IHF-beta). It is known to act as a transcription factor at many gene regulatory regions in E. coli. IHF is an essential cofactor in phage lambda site-specific recombination, having an architectural role during assembly of specialized nucleoprotein structures (snups). IHF is also involved in formation as well as maintenance of bacterial biofilms since it is found in complex with extracellular DNA (eDNA) within the extracellular polymeric substances (EPS) matrix of many biofilms. This subfamily also includes the protein Hbb from tick-borne spirochete Borrelia burgdorferi, responsible for causing Lyme disease in humans. Hbb, a homodimer, shows DNA sequence preferences that are related, yet distinct from those of IHF.
cd00591	HU_IHF	9.34e-12	8	91	2	85	DNA sequence specific (IHF) and non-specific (HU) domains. This family includes integration host factor (IHF) and HU, also called type II DNA-binding proteins (DNABII), which are small dimeric proteins that specifically bind the DNA minor groove, inducing large bends in the DNA and serving as architectural factors in a variety of cellular processes such as recombination, initiation of replication/transcription and gene regulation. IHF binds DNA in a sequence specific manner while HU displays little or no sequence preference. IHF homologs are usually heterodimers, while HU homologs are typically homodimers (except HU heterodimers from E. coli and other enterobacteria). HU is highly basic and contributes to chromosomal compaction and maintenance of negative supercoiling, thus often referred to as histone-like protein. IHF is an essential cofactor in phage lambda site-specific recombination, having an architectural role during assembly of specialized nucleoprotein structures (snups). Bacillus phage SPO1-encoded transcription factor 1 (TF1) is another related type II DNA-binding protein. Like IHF, TF1 binds DNA specifically and bends DNA sharply.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR17553.1	2.23e-109	1	358	1	444
ANU57570.1	2.23e-109	1	358	1	444
BCA50162.1	7.63e-104	1	358	1	487
QMW87934.1	6.09e-103	1	358	1	487
QQA06541.1	6.09e-103	1	358	1	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J0N_I	4.25e-10	5	90	2	87	ChainI, Integration host factor subunit alpha [Escherichia coli],5J0N_K Chain K, Integration host factor subunit alpha [Escherichia coli]
1IHF_A	4.57e-10	5	90	3	88	INTEGRATIONHOST FACTOR/DNA COMPLEX [Escherichia coli],1OUZ_A Chain A, Integration Host Factor Alpha-subunit [Escherichia coli],1OWF_A Chain A, Integration Host Factor Alpha-subunit [Escherichia coli],1OWG_A Crystal structure of WT IHF complexed with an altered H' site (T44A) [Escherichia coli],2HT0_A IHF bound to doubly nicked DNA [Escherichia coli],5WFE_K Cas1-Cas2-IHF-DNA holo-complex [Escherichia coli S88]
2IIE_A	3.51e-09	5	90	47	132	singlechain Integration Host Factor protein (scIHF2) in complex with DNA [Escherichia coli]
2IIF_A	1.18e-08	5	90	47	132	ChainA, Integration host factor [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5P7Y1	3.07e-10	1	95	1	95	Integration host factor subunit alpha OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=ihfA PE=3 SV=1
A0KKP3	6.97e-10	5	107	3	98	Integration host factor subunit alpha OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=ihfA PE=3 SV=1
Q7MK44	1.21e-09	5	90	3	88	Integration host factor subunit alpha OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=ihfA PE=3 SV=1
Q8DA35	1.21e-09	5	90	3	88	Integration host factor subunit alpha OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=ihfA PE=3 SV=1
Q7N3Q2	1.30e-09	5	95	3	93	Integration host factor subunit alpha OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=ihfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
199	221