CAZyme Information: MGYG000000781_01890

Basic Information

• Species: Phocaeicola sp900541515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900541515
• CAZyme ID: MGYG000000781_01890
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000000781_33|CGC1	41247.42	4.8251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000781	3237958	MAG	China	Asia

• Gene Location: Start: 1337; End: 2437 Strand: -

Full Sequence      

MRHFLNKILVPIFGLGLVATSCSDWTELEPKYAKDLTQTDRSEEYYEALRAYKQSDHAVA
FGWYGNVTGIGVNLENCLAGLPDSVDFVSLWGGWKGMTPEVQKDLKFVQTVKGTKALACC
IIMEMGDQITPEEHNATREDRHRFWGWVDGDEEAIKASIVRFANAFADTIDKYNLDGFDL
DWEPSYAQPFETNKEMCKNGRIKIFLQTLIDRGLGARAGKGKLLVIDGEPEHSEIPAEMG
KDFNYFIGQAYGSWGDSDLDGRLSRIISHYEGVLTPEECAKKFIVCENFESYAQTGGVSG
YYDRDGNGPYQSLEGMARWKPKYQDQIFSRSGGVGTFHMEYEYTVSGMSGNYPFLRKAIQ
IMNPSK

Enzyme Prediction     

No EC number prediction in MGYG000000781_01890.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16141	DUF4849	4.70e-77	44	361	23	318	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
cd06542	GH18_EndoS-like	8.05e-53	59	352	2	251	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
COG3325	ChiA	2.00e-04	25	183	21	176	Chitinase, GH18 family [Carbohydrate transport and metabolism].
cd02878	GH18_zymocin_alpha	5.81e-04	153	183	85	116	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
pfam00704	Glyco_hydro_18	0.001	144	191	70	121	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASE18180.1	2.46e-132	7	365	2	361
QKH88101.1	2.46e-132	7	365	2	361
ADK97249.1	2.46e-132	7	365	2	361
AUI56358.1	3.49e-132	7	365	2	361
QUB82195.1	4.95e-132	7	365	2	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	4.40e-54	5	363	4	356	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000021	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000781_01890.