CAZyme Information: MGYG000000775_00045

Basic Information

• Species: Bifidobacterium sp900551485
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium sp900551485
• CAZyme ID: MGYG000000775_00045
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
903	MGYG000000775_1|CGC3	101603.65	4.3443

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000775	1891758	MAG	Japan	Asia

• Gene Location: Start: 47988; End: 50699 Strand: +

Full Sequence      

MIHTPSTFAPLSKGWTLTAMNPDVVPEGLRDQLVAGIPATVPGEATLDLLNAGLIPDPFD
GDNENKLQWIGDVDWRFTCHFDWKADENTRHDLVAYGLDTVASIAVNGDPVGETQNCHRS
YRWDIRELLHDGANELTVTFMSPVRFSDMEEQRRGYYPHTEHHAFNQIRKPSYSFGWDWG
VDVANAGIWREIGIDSWSGVRLAEVRPLVDVASDGTGILNVHVKVEREGAGRIMNPMDAH
KFQTPVPVHVTLEGYGSMLEADGSVDQGRDETTITIAVPNAKLWWPLGYGDQPLYSVDIT
AGADLQAEWKGRVGFRTTHVDTRADDYGRPFQIYVNDVPVHAHGYNWIPDDAFIARVTKK
DYERGVRDLVESNSNMIRVWGGGIYEDDELYDLCDEYGVMVWQDFMLACAAYPEDAETKE
EVEAEAREAIIRLSPHPSLIVWNGSNENYVAYAEWGGYKQAVRDDDLPANEYGYGEKGWG
DYYYSELFPQLLAQLDPTHVYLPSSPMSFTKFTNANWDTDGTMHIWDAWNRKDYRIYAEY
TPRFADEFGYQAPPAWSTLVGAVHDEKLEPFGKQMLVHQKAMGGNYKLARGMRSHITPGH
LDDVSFGGVVNGKPSDGEHSWLIPTDNWDDIQDWHWATQLQQAQAMRFGVEHMRGLAPVN
AGALIWQLNDDWPVVSWAAVDFNGHRKPVWYASRDFFAPRLATIQPRTSEEYRETHSWEG
VKVDTDHLELIVLNDTNTPWSGSWKVSRVDFDGNVLATQEIADVELDAASHKGYPLNDEI
VDFDDANNELIIAVPSDDSFARVIYNPAEILTQELVAPAQAFSTQAERTADGVELTVTAN
DYVRDLFCMVDKVDEKATVEEGLVSLLPGESVTFHIGTDYAGDPNDFAAANVLRSANDLK
RDF

Enzyme Prediction     

No EC number prediction in MGYG000000775_00045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	7	787	6.9e-91	0.7061170212765957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.24e-56	36	710	29	649	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.47e-06	97	447	134	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	7.15e-05	166	527	153	465	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	3.93e-04	332	452	7	140	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGW84386.1	0.0	1	903	1	903
ATU20093.1	0.0	1	902	1	900
ASW23786.1	0.0	1	901	1	901
AIZ15634.1	0.0	1	901	1	901
AII75504.1	0.0	1	903	1	904

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.05e-123	35	876	31	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.07e-123	35	876	31	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	7.47e-123	35	876	29	830	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	7.65e-123	35	876	31	832	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
5N6U_A	2.24e-114	39	770	46	708	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	1.17e-88	40	870	31	820	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1D911	3.12e-87	10	743	8	695	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	3.12e-87	10	743	8	695	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
I2C092	5.21e-87	42	882	32	842	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
A1CGA8	8.26e-87	10	743	8	695	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000775_00045.