CAZyme Information: MGYG000000764_01118

Basic Information

• Species: Porphyromonas_A sp900541275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A; Porphyromonas_A sp900541275
• CAZyme ID: MGYG000000764_01118
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761	MGYG000000764_10|CGC1	86165.37	5.1364

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000764	1992577	MAG	Bangladesh	Asia

• Gene Location: Start: 13765; End: 16050 Strand: +

Full Sequence      

MSSTSYILRLLLSCAALVGGLSAYSQEEDYTLIPMPQHVESLSEGYYEWSDGVRLSLPET
LSDLLPIARELVGEIKEAGEVSGLSVSCEESTDRSMIHFEYDPGMTPDGYTLRITPDAGV
LLRYKEIEGARYALQTLRQLITPRGLPSLEIEDRPRLPYRGLMLDVSRHYMPLPFILRLL
DEMARYKLNKLHWHLTDGGGWRLEIKSIPELVGKTAYRSEPHFMTWWDSGDRRHIPSDSI
GGYGGYYTQEEVREVVRFAQERGIEVIPEIEMPSHSSEVLYALPQLSCSGSPARYERDLC
LGNPETYTFIHRVLDEVMDLFPSQYIHIGGDEADKRGWETCSRCKALCDREGLESTDALQ
GYFMTSISEYVTSRGRTAIGWDDVLGGGAPHEMTIMSWRGEEGGITAAKSGHDAIMCPVG
ILYLDYYQSDRRYEPEANGWTTTFMRTYGYDPIPPSLTSDEKRHIVGVQGNLWTEYVPTP
EHAEYMIFPRLLSLAEIGWTEVSRKDPECFKWRLNREVERLRGRGVNSYSPSSILDESMT
VDNAHRRILVTLESERRPLEVHYTLDGTIPTLSSPRYSLGDTIVVSDSARIMAAHFVAGR
IDGRVTEVDADYHLGVGKRLTWLTPTSREYASVGLETALLDGVRGTANFSDGKWLGTRAS
RDNVALIDLGVVQPIHKVSTRCMQQAGPGLYMPRWVEVSLSEDGQTFTSCGRILSATSPD
DRRQRIETFTTRTDRKARYIKVHYHMPTDDKYLMTDEIVIW

Enzyme Prediction     

No EC number prediction in MGYG000000764_01118.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	157	501	1.5e-111	0.9584569732937686

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	2.92e-177	158	514	2	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	9.18e-149	158	500	2	344	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	8.68e-119	30	577	134	685	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	5.46e-85	159	514	3	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06570	GH20_chitobiase-like_1	1.05e-79	158	514	2	311	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT53805.1	1.47e-208	10	761	14	725
QJE28072.1	2.94e-208	10	761	14	725
QCY55921.1	2.94e-208	89	761	61	725
QUT18521.1	2.94e-208	10	761	14	725
QIX66554.1	4.15e-208	10	761	14	725

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	4.17e-138	11	742	7	745	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7CBN_A	1.51e-96	33	533	14	515	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
7DUP_A	5.82e-87	28	527	2	519	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	3.10e-86	28	527	2	519	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
3RCN_A	1.07e-85	102	533	72	517	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	2.33e-115	11	579	16	583	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	1.12e-95	33	533	33	534	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	3.65e-77	31	498	140	604	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	4.10e-64	103	523	53	482	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
Q04786	2.38e-52	32	506	200	724	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000482	0.998848	0.000200	0.000160	0.000153	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000764_01118.