CAZyme Information: MGYG000000760_01165

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000000760_01165
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		40089.26	9.8063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000760	2818339	MAG	Bangladesh	Asia

• Gene Location: Start: 31153; End: 32211 Strand: -

Full Sequence      

MRRYRLFLLVFASMIISMKMVAQFYTLRPEVAHVQVRPVKHIVTKQKKDSVGAKQPDVTF
QTGRGLKITIEKDVPLFVNVKDSLLFNLISQRMNVCLPLDFLKLNSAFGYRKDPVSRCAA
FHDGIDLECNHARVYAMLPGIIKEVHFGNRGYGNYVVLEHGIFECLYGHLDRITVRAGDA
VSAGTIVGISGNTGKSTGPHLHIRIRKGGKSVDPNVFVDYLNGYITQLQDKMSYIRFGTK
PNRELNIENLMATLRQFDVKFPQIVAAQALLETGYFTSRVCLENNNLFGLRRPSNGSYYT
FNSWEESVKAYKDYVQYKYKGGNYYEFLNRIGYAEDGSYISKVMSLERSLFS

Enzyme Prediction     

No EC number prediction in MGYG000000760_01165.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01551	Peptidase_M23	4.81e-31	121	214	2	96	Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.
COG0739	NlpD	6.73e-30	97	231	138	274	Murein DD-endopeptidase MepM and murein hydrolase activator NlpD, contain LysM domain [Cell wall/membrane/envelope biogenesis].
cd12797	M23_peptidase	1.77e-26	122	205	1	85	M23 family metallopeptidase, also known as beta-lytic metallopeptidase, and similar proteins. This model describes the metallopeptidase M23 family, which includes beta-lytic metallopeptidase and lysostaphin. Members of this family are zinc endopeptidases that lyse bacterial cell wall peptidoglycans; they cleave either the N-acylmuramoyl-Ala bond between the cell wall peptidoglycan and the cross-linking peptide (e.g. beta-lytic endopeptidase) or a bond within the cross-linking peptide (e.g. stapholysin, and lysostaphin). Beta-lytic metallopeptidase, formerly known as beta-lytic protease, has a preference for cleavage of Gly-X bonds and favors hydrophobic or apolar residues on either side. It inhibits growth of sensitive organisms and may potentially serve as an antimicrobial agent. Lysostaphin, produced by Staphylococcus genus, cleaves pentaglycine cross-bridges of cell wall peptidoglycan, acting as autolysins to maintain cell wall metabolism or as toxins and weapons against competing strains. Staphylolysin (also known as LasA) is implicated in a range of processes related to Pseudomonas virulence, including stimulating shedding of the ectodomain of cell surface heparan sulphate proteoglycan syndecan-1, and elastin degradation in connective tissue. Its active site is less constricted and contains a five-coordinate zinc ion with trigonal bipyramidal geometry and two metal-bound water molecules, possibly contributing to its activity against a wider range of substrates than those used by related lytic enzymes, consistent with its multiple roles in Pseudomonas virulence. The family includes members that do not appear to have the conserved zinc-binding site and might be lipoproteins lacking proteolytic activity.
PRK11649	PRK11649	5.48e-12	103	214	293	406	putative peptidase; Provisional
pfam01832	Glucosaminidase	6.01e-12	262	316	15	80	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB41748.1	6.06e-233	1	350	1	350
ASE17922.1	8.64e-232	1	350	1	350
QUB53548.1	2.89e-230	1	350	1	350
QUI93470.1	2.89e-230	1	350	1	350
QUB51704.1	4.10e-230	1	350	1	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J1L_A	1.24e-16	98	220	40	166	Crystalstructure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1L_C Crystal structure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1M_A Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695],5J1M_C Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695]
6JMX_A	1.10e-14	104	229	131	256	ChainA, Peptidase M23 [Campylobacter jejuni],6JMY_A Chain A, Peptidase M23 [Campylobacter jejuni],6KV1_A Chain A, Peptidase M23 [Campylobacter jejuni]
3SLU_A	5.36e-14	98	214	222	338	Crystalstructure of NMB0315 [Neisseria meningitidis ATCC 13091],3SLU_B Crystal structure of NMB0315 [Neisseria meningitidis ATCC 13091]
6MUK_A	6.17e-14	98	214	242	358	1.93Angstrom Resolution Crystal Structure of Peptidase M23 from Neisseria gonorrhoeae. [Neisseria gonorrhoeae FA 1090]
6JN7_A	2.35e-13	104	229	131	256	ChainA, Peptidase M23 [Campylobacter jejuni],6JN7_B Chain B, Peptidase M23 [Campylobacter jejuni],6JN7_C Chain C, Peptidase M23 [Campylobacter jejuni],6JN8_A Chain A, Peptidase M23 [Campylobacter jejuni]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44693	7.54e-13	111	214	337	442	Uncharacterized metalloprotease HI_0409 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0409 PE=3 SV=1
P10548	1.41e-09	108	204	252	351	Lysostaphin OS=Staphylococcus staphylolyticus OX=1287 GN=lss PE=3 SV=1
P10547	1.44e-09	108	204	265	364	Lysostaphin OS=Staphylococcus simulans OX=1286 GN=lss PE=1 SV=2
O05156	3.36e-09	108	204	136	235	Glycyl-glycine endopeptidase ALE-1 OS=Staphylococcus capitis OX=29388 PE=1 SV=1
Q89AI9	3.53e-09	95	214	220	344	Uncharacterized metalloprotease bbp_296 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) OX=224915 GN=bbp_296 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.587905	0.405462	0.003853	0.000877	0.000517	0.001375

TMHMM  Annotations     

start	end
5	27