CAZyme Information: MGYG000000755_00346

Basic Information

• Species: Campylobacter sp013416015
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter sp013416015
• CAZyme ID: MGYG000000755_00346
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	MGYG000000755_2|CGC1	88633.17	7.3291

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000755	1680879	MAG	Bangladesh	Asia

• Gene Location: Start: 31702; End: 34035 Strand: +

Full Sequence      

MKSLAYFSPFLPALSGIAVYSHEILQELKNYFDITLVSDDKCDEKGFKIISFAKFYETSS
AYDYALYNIGNHLHFHAKIYEAMMKIPGVVILHDFFIFELMPVCQNLEDEAYYCHGLKAR
VEHFFNAYKSFGSKYPLNRRILENARVCIAHTQKSLELAKKFYNNDEVFKLLLLPRKLSY
PNKLEAKKSLGFEGKCLYCSFGLLHDSKMNYELLEAWDLTLKNDDRFMLIFAGGSGDDEY
FIKINNFIKENNIKNVKITGWLNSDEYNLYQAAADISVQLRKKERGESSGAILDCFNNES
LVIANFSDYKAQSLYIDDISKLKNALIQSKEILNTDKFKNIIKSAKEKIINEHSTAIFAS
NLAGILEQAYQKPFKMKNILKARILIDISAIYITDARTGISRVVWQELNALIKVSHLPVH
VVAYDNNLKSYKFVDEFILKAHGVAFKSCLDGEVIPQNGDIFYGLDFAVLYGDEKCELPV
LQAYKNGFFDKLKKAGAKAYFRVYDLLPLTNPQFFPFNAARLHLSWLDTLKNINAHLIAI
SNRVYDDLMAFGIQNASVVHLGSHFKISNPAKNKNKIKNFLMVGTIEERKAQKAVALSFL
RLASQGIKARLIIAGRIGRVDDDFKKFLAECECGVDELLNFKDKENNEILNETGMPKTPL
ANEKHANIYFTSFINDDELNRLYESCDCLIAASWDEGFGLPIIEALSHQKAVLARDIAVF
REVGGENALYFKDNFELYDILKALCNGNLELKEPVCKIRTYKDCARDLLKTFGIENE

Enzyme Prediction     

No EC number prediction in MGYG000000755_00346.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	574	732	3.8e-20	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	7.57e-41	383	731	1	315	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03801	GT4_PimA-like	1.82e-19	383	749	1	336	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.85e-13	384	753	1	348	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	5.58e-11	580	723	5	116	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd01635	Glycosyltransferase_GTB-type	1.77e-10	557	731	90	235	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI05913.1	0.0	1	777	1	777
AGZ81382.1	1.71e-213	4	770	3	737
AVK80805.1	1.71e-213	4	770	3	737
AJB45130.1	1.71e-213	4	770	3	737
ALV64481.1	6.86e-213	4	770	3	737

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000755_00346.