CAZyme Information: MGYG000000722_01532

Basic Information

• Species: RC9 sp900545245
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900545245
• CAZyme ID: MGYG000000722_01532
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
993	MGYG000000722_26|CGC1	111730.29	6.6814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000722	2915024	MAG	Kazakhstan	Asia

• Gene Location: Start: 41728; End: 44709 Strand: +

Full Sequence      

MWNSFLMNKNGAVVLAALLCLAATFPLRAQVSLSETTSGRNVFPLSAKTCAAIMYDAVSE
PSVVGTAVGLLASDIEKVTGRVPSVSGNGSVPASCRYAVIAGTLGHSSLIDALVRERKID
VSSISGDWERYAVRLVEAPLKGVRRALVVVGSDRRGTAYGLLSLSRAIGVNPWYWWMDAP
VERRNSIYLSVNAYDAATPSVKYRGIFINDEDWGLLRWAKRNFEKELGNIGPKTYEKVCE
LLLRLNANMLAPAMHEASTAFYQIPQNKEIADRYGIIITASHCEPLLLNTASEWHKDRYG
DWNYNTNSARIDSVLNARVVETSPYENAYVIALRGLHDRAMSGGESLDSRKATVQRALLN
QRKILSDVLGKDASEIPQFFTPYKEVLDVYNQGLELPDDVTIVWPDDNYGYMKRLSGPKE
QLRSGRSGVYYHSSYLGRPHDYLWMNTTSPTLMYEELRKAYDSTADRYWLLNSGDIKSCE
FAVDFFLSMAYDIDSFNYERAASYRSEWLCGMLGEKNRDTYRSIFDEFYHQAFIRKPEFM
GWGYQWTTDRHGNERNTDTDFSFANYREAERRLEAYRKISSETETLMAQLPSSHIPCFYQ
SVYYPVKACELMSRMVLSGQKNRWYALQRRAAATAAADEAIRCHDSLRVITEGYNSLLDG
KWNHVMTMGQGFAASYFKKPVLRDVKLSPTPELGVMVENEGSLNGVSSYHLLPAFNSYFR
CAYFIDIFNRGKGQLSWAAETDKEWILLSRTSGKTADEDRIMVSVDWNNVPVGDKIAGTV
TIKDGSGVQENVLVSVFNPSSPTREDLNGIYVQHNGYVSIDAAGYHRKRENDAIRVIDIS
NLGIENKAVQFGNPMMPKQNTRKGDVPCVEYDFYTFEQGSVDVYTYVLPTFVLSADRGYS
GHEATNVETQYGVCIDDGPVMNPSTSSVEYAQIWYESCLKNCRVNKTTLHINEPGRHSIR
ILCGDAGTVLQKIVLDFGGLKRSYLGPEPTMVK

Enzyme Prediction     

No EC number prediction in MGYG000000722_01532.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	46	676	5.6e-212	0.8249641319942611

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	8.02e-154	198	539	2	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.07e-42	811	989	2	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
PRK11914	PRK11914	4.24e-05	73	153	6	74	diacylglycerol kinase; Reviewed
pfam13004	BACON	0.007	736	795	2	59	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89091.1	0.0	7	990	1	982
ALJ59884.1	0.0	7	990	1	982
EDV06188.1	0.0	12	990	6	982
QDO71503.1	0.0	12	990	4	980
QGT72411.1	0.0	9	990	2	980

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	5.56e-146	71	990	42	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	3.56e-135	59	663	35	612	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	1.37e-99	37	666	38	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	2.55e-93	25	990	5	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
7PUG_A	7.48e-84	70	667	40	626	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001148	0.997778	0.000482	0.000196	0.000182	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000722_01532.