CAZyme Information: MGYG000000722_01522

Basic Information

• Species: RC9 sp900545245
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900545245
• CAZyme ID: MGYG000000722_01522
• CAZy Family: GH130
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
988	MGYG000000722_26|CGC1	110927.58	7.0068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000722	2915024	MAG	Kazakhstan	Asia

• Gene Location: Start: 19450; End: 22416 Strand: -

Full Sequence      

MSKTTRTRKLLTMVTAVLTAICCCLPASGKKSHSERSYDVVIVGGTPSGIMAAIAAAREG
CSCIILERSEYVGGLPVNGLGATDIATRGSTTGLFTEFTRLNLQYYKDRFGEDSPQVRDC
SDGYHFEPHVAQMTFDKLLGESYAGKITVLTMRQFDPSKGNVQMHGNRISAIRVLNRTNG
KTEKWRGKVFIDATYEGDLGAAAGIPFRLGREGRDEFGEPCAGKIYRWWKHGPDEVGTTY
EGDDEIQAYNYRLCLTNNTDNLVPIARPENYDRNEYLSLVEDVLTGRNTDVRFKSVTVEQ
MEENRKRILSGGKTAIPGDTWGMSKVTNMVTLPNMKKDGNNQHLALISTDLPEENKPWPT
ADWEWRDNFAQRLKDYTLGLLWFAQHDEALPENFRKACLRYGLAADEYTDNGNFPRQVYV
REGRRLEGTYFFTAKDVLPTKKGARPPIHSESVTSSHYALDSHAVHKREDGRVHLDGFFS
YPTAVYTVPYGVMVPTTVENLLFPVAVSGSHVGFSTLRMEPCWMALGEAAGYAASVAVHK
DFKVREIPITEIQKKILNNGGTLVYFKDLTPEDKDFRQVQILALKGYFPDWKASLDKKID
ENTAKLWSELSGRDIKCDNGTKRQWLRALEGNDINDTTPDWALPEFRRPDGSGPVIAPDS
TLTFTCPCSGKKVRWAERDTFNPAAVVKDGKIVVLFRAEDNYGEGIGKRTSRIGYATSKD
GMHFNVEEEPIMYPDNDDQHSLEWPGGCEDPRIVETEDGLYVMTYTQWNRKTARLAVATS
TDLRHWTKHGPAFGKAYNGRFRDMFCKSGSVVTKIMNGKQVVAKVGGKYLMYWGERFVNI
AMSEDLLNWTPLLDEKGNIMKIATPRPGHFDSDMTECGPPAIITDNGILLIYNGRNRSGK
DRDRRYAANSYCAGQMLFDTKDPSRLIGRMDEPFLIPEKEFEKCGQYPDGTVFVEGLVLY
KGRWHLYYGCADSLVGTASAVPLNYMTP

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH130	671	980	1.1e-85	0.918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18610	GH130_BT3780-like	6.02e-167	666	980	1	301	Glycosyl hydrolase family 130, such as beta-mammosidase BT3780 and BACOVA_03624. This subfamily contains glycosyl hydrolase family 130, as classified by the carbohydrate-active enzymes database (CAZY), and includes Bacteroides enzymes, BT3780 and BACOVA_03624. Members of this family possess 5-bladed beta-propeller domains similar to families 32, 43, 62, 68, 117 (GH32, GH43, GH62, GH68, GH117). GH130 enzymes are involved in the bacterial utilization of mannans or N-linked glycans. GH130 enzymes have also been shown to target beta-1,2- and beta-1,4-mannosidic linkages where these phosphorylases mediate bond cleavage by a single displacement reaction in which phosphate functions as the catalytic nucleophile. However, some lack the conserved basic residues that bind the phosphate nucleophile, as observed for the Bacteroides enzymes, BT3780 and BACOVA_03624, which are indeed beta-mannosidases that hydrolyze beta-1,2-mannosidic linkages through an inverting mechanism.
pfam12831	FAD_oxidored	3.98e-90	39	555	1	419	FAD dependent oxidoreductase. This family of proteins contains FAD dependent oxidoreductases and related proteins.
cd18607	GH130	7.00e-89	675	979	1	268	Glycoside hydrolase family 130. Members of the glycosyl hydrolase family 130, as classified by the carbohydrate-active enzymes database (CAZY), are phosphorylases and hydrolases for beta-mannosides, and include beta-1,4-mannosylglucose phosphorylase (EC 2.4.1.281), beta-1,4-mannooligosaccharide phosphorylase (EC 2.4.1.319), beta-1,4-mannosyl-N-acetyl-glucosamine phosphorylase (EC 2.4.1.320), beta-1,2-mannobiose phosphorylase (EC 2.4.1.-), beta-1,2-oligomannan phosphorylase (EC 2.4.1.-) and beta-1,2-mannosidase (EC 3.2.1.-). They possess 5-bladed beta-propeller domains similar to families 32, 43, 62, 68, 117 (GH32, GH43, GH62, GH68, GH117). GH130 enzymes are involved in the bacterial utilization of mannans or N-linked glycans. Beta-1,4-mannosylglucose phosphorylase is involved in degradation of beta-1,4-D-mannosyl-N-acetyl-D-glucosamine linkages in the core of N-glycans; it produces alpha-mannose 1-phosphate and glucose from 4-O-beta-D-mannosyl-D-glucose and inorganic phosphate, using a critical catalytic Asp as a proton donor.
cd18614	GH130	4.08e-62	675	980	1	274	Glycosyl hydrolase family 130; uncharacterized. This subfamily contains glycosyl hydrolase family 130 (GH130) proteins, as classified by the carbohydrate-active enzymes database (CAZY), most of which are as yet uncharacterized. GH130 enzymes are phosphorylases and hydrolases for beta-mannosides, and include beta-1,4-mannosylglucose phosphorylase (EC 2.4.1.281), beta-1,4-mannooligosaccharide phosphorylase (EC 2.4.1.319), beta-1,4-mannosyl-N-acetyl-glucosamine phosphorylase (EC 2.4.1.320), beta-1,2-mannobiose phosphorylase (EC 2.4.1.-), beta-1,2-oligomannan phosphorylase (EC 2.4.1.-) and beta-1,2-mannosidase (EC 3.2.1.-). They possess 5-bladed beta-propeller domains similar to families 32, 43, 62, 68, 117 (GH32, GH43, GH62, GH68, GH117). GH130 enzymes are involved in the bacterial utilization of mannans or N-linked glycans. Beta-1,4-mannosylglucose phosphorylase is involved in degradation of beta-1,4-D-mannosyl-N-acetyl-D-glucosamine linkages in the core of N-glycans; it produces alpha-mannose 1-phosphate and glucose from 4-O-beta-D-mannosyl-D-glucose and inorganic phosphate, using a critical catalytic Asp as a proton donor.
cd08993	GH130	2.04e-50	681	980	7	273	Glycosyl hydrolase family 130. This subfamily contains glycosyl hydrolase family 130 (GH130) proteins, as classified by the carbohydrate-active enzymes database (CAZY), are phosphorylases and hydrolases for beta-mannosides, and include beta-1,4-mannosylglucose phosphorylase (EC 2.4.1.281), beta-1,4-mannooligosaccharide phosphorylase (EC 2.4.1.319), among others that have yet to be characterized. They possess 5-bladed beta-propeller domains similar to families 32, 43, 62, 68, 117 (GH32, GH43, GH62, GH68, GH117). GH130 enzymes are involved in the bacterial utilization of mannans or N-linked glycans. Beta-1,4-mannosylglucose phosphorylase is involved in degradation of beta-1,4-D-mannosyl-N-acetyl-D-glucosamine linkages in the core of N-glycans; it produces alpha-mannose 1-phosphate and glucose from 4-O-beta-D-mannosyl-D-glucose and inorganic phosphate, using a critical catalytic Asp as a proton donor. This family includes Ruminococcus albus 4-O-beta-D-mannosyl-D-glucose phosphorylase (RaMP1) and beta-(1,4)-mannooligosaccharide phosphorylase (RaMP2), enzymes that phosphorolyze beta-mannosidic linkages at the non-reducing ends of their substrates, and have substantially diverse substrate specificity that are determined by three loop regions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX62786.1	5.97e-190	35	565	8	538
QMW86448.1	1.72e-168	639	984	31	376
AAO79199.1	1.72e-168	639	984	31	376
ALJ43658.1	1.72e-168	639	984	31	376
QQA07834.1	1.72e-168	639	984	31	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3R67_A	7.35e-168	639	984	10	355	Crystalstructure of a putative glycosidase (BT_4094) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.30 A resolution [Bacteroides thetaiotaomicron VPI-5482],3R67_B Crystal structure of a putative glycosidase (BT_4094) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.30 A resolution [Bacteroides thetaiotaomicron VPI-5482],3R67_C Crystal structure of a putative glycosidase (BT_4094) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.30 A resolution [Bacteroides thetaiotaomicron VPI-5482],3R67_D Crystal structure of a putative glycosidase (BT_4094) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.30 A resolution [Bacteroides thetaiotaomicron VPI-5482]
5A7V_A	2.11e-158	632	978	28	373	TheGH130 family of mannoside phosphorylases contains glycoside hydrolases that target beta-1,2 mannosidic linkages in Candida mannan [Bacteroides thetaiotaomicron]
5A7V_B	2.11e-158	632	978	28	373	TheGH130 family of mannoside phosphorylases contains glycoside hydrolases that target beta-1,2 mannosidic linkages in Candida mannan [Bacteroides thetaiotaomicron]
3QC2_A	7.20e-151	632	978	5	350	Crystalstructure of a glycosyl hydrolase (BACOVA_03624) from Bacteroides ovatus at 2.30 A resolution [Bacteroides ovatus ATCC 8483],3QC2_B Crystal structure of a glycosyl hydrolase (BACOVA_03624) from Bacteroides ovatus at 2.30 A resolution [Bacteroides ovatus ATCC 8483]
3TAW_A	3.32e-149	641	985	12	356	Crystalstructure of a putative glycoside hydrolase (BDI_3141) from Parabacteroides distasonis ATCC 8503 at 1.70 A resolution [Parabacteroides distasonis ATCC 8503]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0K2C2	1.07e-33	675	978	21	287	1,2-beta-oligomannan phosphorylase OS=Thermoanaerobacter sp. (strain X514) OX=399726 GN=Teth514_1788 PE=1 SV=1
B0K2C3	4.37e-23	671	978	17	293	Beta-1,2-mannobiose phosphorylase OS=Thermoanaerobacter sp. (strain X514) OX=399726 GN=Teth514_1789 PE=1 SV=1
Q92DF6	2.07e-17	711	973	107	334	Beta-1,2-mannobiose phosphorylase OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=lin0857 PE=1 SV=1
Q795R8	2.66e-06	36	182	2	168	Uncharacterized protein YtfP OS=Bacillus subtilis (strain 168) OX=224308 GN=ytfP PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.010061	0.465494	0.516124	0.005057	0.001759	0.001477

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000722_01522.