CAZyme Information: MGYG000000722_01464

Basic Information

• Species: RC9 sp900545245
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900545245
• CAZyme ID: MGYG000000722_01464
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000000722_24|CGC2	40897.61	7.0653

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000722	2915024	MAG	Kazakhstan	Asia

• Gene Location: Start: 44215; End: 45318 Strand: -

Full Sequence      

MKTKHLIILLTASFLFVGTSVTAFAKGRTKVTDASDSKITYIGRVLKEGPNVSFDWSGVQ
CRLRFNGTGISLRCSDTKANYYNVWIDKETGCAPDLVIRTAGKDTTIVLAEKLGKGIHNL
TLLKRTEGEQGKTTFHSFETTGELLQADPVRKRLIEFVGDSYTCGYGTENSVKDDPFKPE
TENCNLTYAAIASRYFDADCILVCHSGRGIARNYDDWGKGTARTTMPEKYEYVFDEAEGP
LCDKPEQTPDLVVVYLGANDFSCGRQPSMELFCQNYHLLLNKIKARYGKETPVLCLAAMQ
DNGIYVYVREACLRSGLEGIWCVGVHRGIYNEDSDLGASMHPNHVGQKKMAFNIIPYIST
ITGWEMK

Enzyme Prediction     

No EC number prediction in MGYG000000722_01464.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	155	358	1.3e-45	0.9904306220095693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	1.64e-27	155	358	2	168	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam17996	CE2_N	2.28e-24	41	147	1	107	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
pfam13472	Lipase_GDSL_2	1.28e-08	157	349	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	1.13e-05	155	351	1	181	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
COG2755	TesA	1.90e-04	153	361	9	211	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL78378.1	3.88e-104	25	365	20	358
CBK63901.1	2.03e-101	25	365	20	358
BBL06909.1	8.79e-95	34	365	28	358
BBL06085.1	1.99e-92	30	366	35	366
AGY53007.1	1.41e-90	1	366	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	1.78e-33	33	364	5	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAA_A	5.78e-22	29	364	10	339	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]
2W9X_A	7.56e-20	43	349	34	357	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]
4XVH_A	1.51e-18	39	364	2	329	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]
3U37_A	1.76e-13	29	356	39	371	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	2.91e-31	29	364	482	814	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	1.26e-23	1	364	1	358	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1
B3PDE5	3.90e-19	43	349	34	357	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999102	0.000168	0.000183	0.000152	0.000138

TMHMM  Annotations     

start	end
5	24