CAZyme Information: MGYG000000722_00964

Basic Information

• Species: RC9 sp900545245
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900545245
• CAZyme ID: MGYG000000722_00964
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654	MGYG000000722_12|CGC1	74905.56	4.7817

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000722	2915024	MAG	Kazakhstan	Asia

• Gene Location: Start: 59141; End: 61105 Strand: +

Full Sequence      

MASLTLMSSCGHSKSDKIQPLAYSELRLGSIKPEGWLRETLLRQRNGMTSQMDSLYPEVM
GPRNGWLGGDGDQWERGPYWIDGLIPMAWILDDDVLKQKAQPWVEWALASQKEDGFFGPD
TDYPYERGLQRDNAHDWWPRMVVLKFMQQYWSATGDSRVIDFMRKYFRYQLNTLPTCPLG
NWTSWATYRACDNLSSVIWLYRLTGEEWLLDLAATLHEQSHDYVHMFLETDELSRLGTIH
CVNLAQGIKEPIVWWQCDPQPKYLDAVHTALADIRKYNGVPSGMYGGDELLHGNNPTQGS
ELCTAVELMFSLEEMTKITGDLSFVDHLERIAFNALPTQLTDDFMARQYFQQANQVDVSH
CIHNFDISHGESDLVYGLLTGYPCCTSNFHQGWPKFVQNLWYSTPDGGLAALAYSPCRVT
AQAGGQEVTIEERTRYPMEGNIKLLVSLHSPASFPLHLRIPSWTENASVTVNGSPVEASA
PGSVTVISREWSDGDIVELSFLMKITTDTWYENSISVERGPLVYALEIQEEWVRKDNSSD
PIHGEFYWEVHPKSPWNYGLVDFEDPNEDFAVTVDERKLDSHWYWNLESAPIVITAKAKR
IPYWTLYNGMTGPIPYSRMYGNPVIRDKKEETIRLIPYGCTTLRISEFPVIFRK

Enzyme Prediction     

No EC number prediction in MGYG000000722_00964.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	300	525	1.7e-33	0.4255725190839695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.74e-49	79	525	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.27e-22	93	527	84	503	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH39723.1	1.64e-152	23	653	38	651
QXU43103.1	6.78e-151	23	651	37	647
ARS39276.1	6.97e-151	23	651	38	648
QNN43859.1	1.01e-150	23	651	38	649
QNR86060.1	5.46e-150	1	651	12	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	8.35e-20	80	608	82	635	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.97e-17	80	608	82	635	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002326	0.000295	0.997424	0.000000	0.000001	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000722_00964.