CAZyme Information: MGYG000000722_00036

Basic Information

• Species: RC9 sp900545245
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900545245
• CAZyme ID: MGYG000000722_00036
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MGYG000000722_1|CGC1	53891.24	6.0446

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000722	2915024	MAG	Kazakhstan	Asia

• Gene Location: Start: 46174; End: 47616 Strand: -

Full Sequence      

MFLKLDGKSTKCSNFADMKKVLIITYYWPPSGGSGVQRWVKFAKYLPQNGWQPVIYTPEN
PELTVVDGTLEDDVPEEAIVLKRPIFEPYGIYRRLTGKGNSKASAGDAEGKSVHGKAGEA
TASEVNPINAQKKSLSQKISLWIRGNFFIPDPRCLWIRPSVKFLKKYLKEHPVDVIVSTG
PPHSMHLIAQKVAASTGIPWVADFRDPWTRMFYFKHLELSSWAERRHERLEKGVLDGADA
IVAVSPLVQDDFKKMTDTPVELITNGFDDDDFDSASEEMRVSEEETGSENEDFFNIVHTG
LFAADGNPLELWRVLAELAAADEEFASKLRIRLSGKTDTQIVEAIAAAGLRKSLVNRGYV
SHDEAVREQCGASILILPLRHEPEYRATLPGKLFEYLASRRPVLGIGQTDGAMARLLGDA
HAGVTFDWDDADGMKKEILRCWTLFRAGKLDDNDGDIDRYSRRRLTRQMAQLFDSLDINR

Enzyme Prediction     

No EC number prediction in MGYG000000722_00036.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	1.57e-38	20	441	1	359	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	6.23e-14	124	480	36	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	1.43e-13	20	440	1	329	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03811	GT4_GT28_WabH-like	4.32e-11	155	468	66	348	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
pfam13439	Glyco_transf_4	9.59e-09	143	266	43	165	Glycosyltransferase Family 4.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHZ59912.1	5.29e-164	63	476	1	404
QKG80549.1	3.54e-129	19	479	7	438
AGY52657.1	8.25e-129	18	476	1	432
ADQ79470.1	1.55e-128	18	476	1	431
AMD85552.1	2.85e-123	18	476	1	427

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000722_00036.