CAZyme Information: MGYG000000707_01995

Basic Information

• Species: Prevotella sp900546575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546575
• CAZyme ID: MGYG000000707_01995
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	MGYG000000707_47|CGC1	51785.35	9.8715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000707	3151200	MAG	Kazakhstan	Asia

• Gene Location: Start: 9818; End: 11194 Strand: +

Full Sequence      

MTRYFRLILCLCALMLTAAMSAQTIKWQELYKVKKKDTIYGIAKKYNITIDELISANPAM
QKPDYTLQKGDQLLIPYPTTTPATATTPAATASKTQTASPVTHKRAADGSVRIGVMLPLH
NVDGDGQRMIEYYRGILMACDSLRSQGIATHVYAWNVPIDANVQQTINDDNARQCDVIFG
PLYTKQVKPIGDFCRKNDIRLVIPFSINGNDVAQNERIYQIFQTPAQQNEASVNAFAERF
KGRHVVIVDCNDTTSRKGVFTSALRKRMEKAGMTYSITNLKSSEQSFAKAFSTTLPNVVV
LNTGRSPELNATLAKLNTLTAATKGLSISLYGYTEWLMYTKVYTDYYFKYDTYIPTTFYY
NPLAGKTIAIERAYRQWFKSDMRQALPRFALTGFDHAQFFIRGLHKYGDRFDGTQQQNTY
TPLQTPLKFKRVGTGGMQNSSFMLVHYKPNRTIESVSY

Enzyme Prediction     

No EC number prediction in MGYG000000707_01995.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	3.64e-10	31	75	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	1.03e-08	31	76	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	1.10e-08	31	75	2	44	Lysin motif.
COG1388	LysM	8.60e-05	31	76	69	111	LysM repeat [Cell wall/membrane/envelope biogenesis].
cd06268	PBP1_ABC_transporter_LIVBP-like	1.72e-04	161	402	57	288	periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity. Members of this group include ABC-type Leucine-Isoleucine-Valine-Binding Proteins (LIVBP), which are homologous to the aliphatic amidase transcriptional repressor, AmiC, of Pseudomonas aeruginosa. The uncharacterized periplasmic components of various ABC-type transport systems are included in this group.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB46898.1	1.10e-195	22	458	23	451
EFC70285.1	1.53e-174	16	458	16	454
ALO48876.1	2.34e-172	5	458	5	448
QYR10688.1	4.42e-163	3	458	6	450
QVJ80666.1	1.01e-151	1	458	1	450

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000551	0.998316	0.000599	0.000178	0.000167	0.000163

TMHMM  Annotations     

start	end
7	25