CAZyme Information: MGYG000000706_00463

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1326
• CAZyme ID: MGYG000000706_00463
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	MGYG000000706_3|CGC2	66773.05	4.9892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000706	2490616	MAG	Kazakhstan	Asia

• Gene Location: Start: 60389; End: 62140 Strand: +

Full Sequence      

MVNNKIEVLDKGNSEDILIEKLEEDDGITIYRIKVKYEHSVYPQRVSLSFAADGTDVFSV
WSPTHTDERSIKPNWHPNISVSRACDGAPIQSALSRSGKNRLTLALSDPKTPLELKMGIR
ENDVWLVAMIDIFTLPVAKIDYYEADLRIDTRPVEFYDAIKEVRTWWNGYGYKNAKVPEA
AKVPVYSTWYSFHQHFDFDAIVKECEASKEYGCETVILDDGWQTEDYSSGYAFCGDWEAC
AAKVGDMAELAERIHALDMKLILWFSVPYVGKNSKAWERFKECFLNDPQKGEWHCLDPRF
PKVREYLIKLYSKAAKEWKLDGFKLDFIDSFTLTDYSIGRIGCGRDVDSIEDAVEILLRD
IMKSLKKINSDICIEFRQKYIGPLMQTYGNMLRVSDCPADSLKNRVGMVDLRLLSGATAV
HSDMLEWNYTDTPENAATQFVNVLYAVPQISIISEKLKPEHKRVLNFYSNFWKEHKNILI
DGEFKAFAPWANYSAVYAEKDGTIIYTAYESRVTEIGSPFEKLVLINGTGKNGLVLDYSS
IESITGRNCIIYDCTGRERYTYNLVQEELRYIPVPNMGMAVIE

Enzyme Prediction     

No EC number prediction in MGYG000000706_00463.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.36e-59	181	474	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	2.06e-09	182	336	1	160	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	1.34e-07	188	327	298	451	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06593	GH31_xylosidase_YicI	5.28e-04	180	327	3	158	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
cd14792	GH27	0.002	186	261	5	82	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMV40951.1	3.03e-163	19	583	23	586
AZS17022.1	1.00e-155	27	582	29	583
QTH41069.1	1.29e-155	25	582	31	588
CQR57728.1	5.18e-155	27	580	32	585
QGQ97599.1	2.98e-150	25	582	30	587

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000706_00463.