CAZyme Information: MGYG000000696_02469

Basic Information

• Species: Parabacteroides sp900549585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900549585
• CAZyme ID: MGYG000000696_02469
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583		66488.37	5.2633

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000696	3184747	MAG	Kazakhstan	Asia

• Gene Location: Start: 6930; End: 8681 Strand: -

Full Sequence      

MNITIITNEYSTGSGGGLSYSCHQLECLLQSMGHSVKVCRSSICETDVIHGGYNNHLGFD
LVKESLLKRCVETISEGNLLIGFGGGYNGYFTALLAQKSRCGYWLMFRGSDANLCKWNFE
NFHYNKYALEKCDKVFALSREIADNIKLVAPNKTDIVVIPNYTERISKQIKAPNKNNIHI
GCGAFHLNEKKGISLLMRMVASYARTYNRDITLECVGQIDDDVLEQYQNLADEMQISDIV
SFTGYMEREDFKRVQGRWDYYIQGSICEGMGNSVIDSMSLGIPVLLTNTGYVAEMANKLY
PEMIFSSYEPSKMAAQLYNMITDEDSLDKYESFYSAFFTSTTEEVIKHLWESQFNNDNHV
AVTKPDGIISLSLHDVDGVSHDNITTPISVFESFVEQVHGRGYILCSMNDYMNRPAYKRK
NCIVCTFDDGYVGLLDNALPIMNRYGFSATVFVCSDYMGDTNKWNFKDKKRRMHLDVDGL
LELQQNGWEIGSHGVTHRSLLRLNDDEIVFELEESKRRLEIIFGPIKSYAYPYGDYSEYI
LGKVSEYYQYAFLLRQGGVYLPVDSLSIHRYYISEINQIIQLS

Enzyme Prediction     

No EC number prediction in MGYG000000696_02469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	419	544	1.1e-25	0.8461538461538461
GT4	187	325	9.6e-18	0.84375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	1.69e-52	423	574	2	155	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10970	CE4_DAC_u1_6s	4.86e-32	422	552	2	123	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10967	CE4_GLA_like_6s	3.84e-31	422	551	2	120	Putative catalytic NodB homology domain of gellan lyase and similar proteins. This family is represented by the extracellular polysaccharide-degrading enzyme, gellan lyase (gellanase, EC 4.2.2.-), from Bacillus sp. The enzyme acts on gellan exolytically and releases a tetrasaccharide of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the nonreducing terminus. The family also includes many uncharacterized prokaryotic polysaccharide deacetylases, which show high sequence similarity to Bacillus sp. gellan lyase. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	1.07e-24	419	551	5	124	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10973	CE4_DAC_u4_5s	1.64e-24	421	575	1	155	Putative catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized bacterial polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALA73438.1	9.36e-141	1	580	1	581
QJR58213.1	9.36e-141	1	580	1	581
AII67656.1	9.36e-141	1	580	1	581
QJR56991.1	9.36e-141	1	580	1	581
ADG83187.1	3.41e-22	401	574	75	255

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	1.16e-13	360	574	57	263	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000696_02469.