CAZyme Information: MGYG000000696_00266

Basic Information

• Species: Parabacteroides sp900549585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900549585
• CAZyme ID: MGYG000000696_00266
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618	MGYG000000696_3|CGC1	70060.17	5.5757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000696	3184747	MAG	Kazakhstan	Asia

• Gene Location: Start: 5425; End: 7281 Strand: -

Full Sequence      

MKQYLLLSIASLIIGGCSVQKQEEAAPLKMINQVDFSHVKIQDSFWSPRLEKHTSATLPV
CIDQIENQTGRMQNFINASKGEGKHSGIFFDDSDVYKALEGIAYSLINNPNPELEEKADE
WISHIASAQQPDGYINTFYTLTGLEKRWKNMDKHEMYCAGHLIEAAVAYYQATGKRTLLD
VGIKMANHMMSIFGPGKRDWVPGHEEIELALVKLYQTTNEEKYLDFAYWLLEERGHGHGS
KGDEGDWNPAYYQDEIPVRNLESISGHAVRCMYLYCGMADVAALKHDTAYISAMNKLWDD
VVLRNMYVTGGIGSSKHNEGFTEDYDLPNLEAYCETCASVGMVYWNQRMNQFTGDSKYID
VLERSMYNGALAGVSLSGDRFFYVNPLESHGDHHRKAWYGCACCPSQISRFLPSIGNYIY
GISNNSIWVNLFIGNTTEISIDNQKVTLKEETNYPWDGIVNLSINAERPVNKDLRIRIPG
WCHQYSLSVNGENKSFGKEKGYVVISNWKPGDKITLDMDMPVEMVSADPRVKQDVGKRAI
QRGPLVYCMEEMDNNHGFSKLALTKNSTFDIEKEEILPGVTHVIHAKTEKGTLTFIPYYA
WDNRDAGNMKVWIDLNNN

Enzyme Prediction     

No EC number prediction in MGYG000000696_00266.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	39	548	9.6e-210	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	0.0	36	613	9	585	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	0.0	38	548	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04792	LanM-like	0.004	101	225	550	674	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49321.1	0.0	1	614	1	614
BCI63957.1	0.0	1	614	1	615
ABR45039.1	0.0	1	616	1	616
AST55952.1	0.0	1	616	1	616
QUT97168.1	0.0	1	616	1	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	4.07e-173	31	615	7	625	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.14e-167	37	614	14	646	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.56e-162	37	614	14	646	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	2.20e-123	38	612	2	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	3.00e-123	38	612	2	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.21e-122	38	612	2	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000068	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000696_00266.