CAZyme Information: MGYG000000695_01422

Basic Information

• Species: Prevotella sp000436035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436035
• CAZyme ID: MGYG000000695_01422
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	MGYG000000695_15|CGC1	38827.69	8.7227

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000695	3484843	MAG	Kazakhstan	Asia

• Gene Location: Start: 10428; End: 11417 Strand: -

Full Sequence      

MQTQQTYPQNIQTPLVSFIITTYNLPLEYLETCLKSILQLSLNPREREIIIIDDGSDLSP
LNDLIDEQDSFIYVRQRNQGLSMARNRGLQMASGQYIQFVDGDDYLLQTAYEHCLDLVRY
HNPDIVYFKFTNKEGEKEVPYQYTEPISGSNYMHNNNLCASAWSYVFKRDILQNLRFTPN
ILHEDEEFTPLLFLKADRVITTDCKAYFYRTRENSIIHQKGNKRHNLKRLADTELVIMHL
QERTALLSEIERVALNRRIAQLTMDYLYNTILLTRSVKHLEEAIKRLHDKGLYPLPDKKY
TKKYQLFCKAIRSKMGRRLMVLTLPQIKK

Enzyme Prediction     

No EC number prediction in MGYG000000695_01422.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	17	142	1.7e-22	0.7470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10073	PRK10073	2.83e-26	12	261	4	255	putative glycosyl transferase; Provisional
cd00761	Glyco_tranf_GTA_type	4.60e-22	19	167	2	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	7.90e-20	17	136	1	121	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04184	GT2_RfbC_Mx_like	2.47e-17	14	127	1	118	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
COG0463	WcaA	4.79e-17	13	317	2	291	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATV33956.1	2.54e-106	1	327	1	326
ATV41436.1	2.54e-106	1	327	1	326
ATV53854.1	1.03e-105	1	327	1	326
ATV26873.1	1.03e-105	1	327	1	326
ATV31592.1	1.45e-105	1	327	1	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URH7	1.39e-07	16	216	7	222	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000695_01422.