CAZyme Information: MGYG000000695_00097

Basic Information

• Species: Prevotella sp000436035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436035
• CAZyme ID: MGYG000000695_00097
• CAZy Family: GH5
• CAZyme Description: Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521		57680.01	5.0404

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000695	3484843	MAG	Kazakhstan	Asia

• Gene Location: Start: 135210; End: 136775 Strand: +

Full Sequence      

MKKFRYLFLMLMAFVCGVSLSACSYEDDDYHAPSFKVLNPELNFDGNGGTQIVNVIADAQ
PTATVMSGKDWHNGDEWCSVVYKDNADGTYNFNVTATPNAEEKQDTAYVRIVSGYSRKDV
MVIRAAKTAVTPDVPPADMNKTAMEVAQLMYPGWNLGNTLEGGDSKNLWKNAGIETETVW
QNAKTTQALIDAVKAAGFKSVRIPCSWVMGHITDAEKCTIDPAWMKRVKEVVDYCIKDGL
YVIINQHWDGGWIEHNGLTANADIKTTKAQLTKIWTQIADNFKTYDEHLLFAGMNEPGVG
AGEGDIIGVAEMSSRIAEYEQTFIEAVRATGGNNAKRVLIVQGPNTNIDKFVANNYMSKI
KDSATDRLMVEVHFYDPYNFTDMSEDQSWGKYCLYWGKNNTNGSEADRTADAKYNEDYVE
AQMKKMKTNFFDKGYPVLIGEFGANQRLAIGKDAVHDASVRDYYKAVVTSAINNGCVPMA
WDTNAGLPSMTIFNRASASVSNNNILEPIQAAVAAAKWPSK

Enzyme Prediction     

No EC number prediction in MGYG000000695_00097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	177	484	8.6e-96	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	6.92e-53	171	485	10	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.42e-21	150	445	51	324	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	3.12e-09	34	123	1	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT65311.1	4.06e-116	117	509	2	419
ADB44000.1	3.55e-105	42	519	50	515
VEH16026.1	3.17e-104	42	517	161	606
QUT37093.1	9.16e-96	37	519	133	592
ABQ03808.1	1.65e-95	6	510	8	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W8A_A	4.25e-103	141	519	1	377	Crystalstructure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W8B_A Crystal structure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in complex with XXLG [uncultured bacterium]
5OYC_A	1.20e-78	139	509	41	389	GH5endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYC_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107]
6HA9_A	9.27e-78	139	509	41	389	Structureof an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HA9_B Structure of an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_A Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_B Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107]
2JEP_A	2.35e-64	120	509	16	390	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
6WQY_A	1.69e-59	141	503	22	370	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	2.54e-59	137	509	33	395	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
A7LXT7	2.82e-58	9	482	19	473	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
P54937	7.56e-50	133	484	30	345	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P28623	2.69e-49	143	497	43	356	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P23660	2.89e-48	142	509	26	359	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000063	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000695_00097.