CAZyme Information: MGYG000000680_00307

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3402
• CAZyme ID: MGYG000000680_00307
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000000680_24|CGC1	41608.28	6.1266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000680	2323759	MAG	Kazakhstan	Asia

• Gene Location: Start: 2844; End: 3953 Strand: -

Full Sequence      

MSWTDEALKQCLDKIEQNIDGIGEHFPHVAYDNVYNDQGPTFWVAGFWPGLLWLRYQATK
DEKALELARKLEDLMDPVLDGFLTLHHDVGFMWLPSAVIDYKLTGNEASRVRGLKAASHL
AGRFNLAGQFIRAWTDRVQVGTQGWAIIDCMMNIPLLFWASKETKDPRFYHIAKAHADTV
LRCFLRPDNTSAHIVSFDPYTGEKIENLGGQGKDPDSAWSRGQAWAIYGMAVAYRETGKE
EYLTASKNVAAYFLSHLSADKVPYWDFRTDEADKWVKDSSAAACAASGLLELHNLVKEPA
EKQFYLDQAFAILKGIYDNYFVASGDSQAMISCGTVNYAKKKHVNVPIIYGDYFFTEALL
KLKGLTNIF

Enzyme Prediction     

No EC number prediction in MGYG000000680_00307.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	37	361	1.1e-117	0.9878419452887538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.58e-17	18	274	1	248	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS17853.1	1.10e-165	3	369	7	373
QKS47105.1	5.62e-161	2	369	6	373
QUH30358.1	2.08e-143	3	369	4	369
QGQ99121.1	6.05e-136	3	369	9	371
QCT01493.1	1.26e-135	3	369	6	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VD5_A	1.95e-68	6	367	4	370	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	1.09e-67	6	367	4	370	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	4.88e-64	5	361	29	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	5.01e-64	5	361	30	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	2.76e-63	5	361	30	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DR77	1.63e-68	4	369	23	395	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9RC92	1.07e-67	6	367	4	370	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8E372	2.74e-63	5	361	30	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9A0T3	8.56e-62	6	361	32	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
T2KLZ3	6.04e-48	43	365	77	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000680_00307.