CAZyme Information: MGYG000000677_01711

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; UBA5920
• CAZyme ID: MGYG000000677_01711
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447		50581.22	4.8518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000677	2015211	MAG	Kazakhstan	Asia

• Gene Location: Start: 194; End: 1537 Strand: +

Full Sequence      

MKNTKICIIGGGSRLWAINFMKDLALNKEAEGTVVLYDIDKEASRNNVEVGKRMLKINNN
EDRFSFVAIDELEPALEGSDLVLIVIEPGKTECRYADLVLPEQYGILETVGDTTGPGGLI
RARRALPLFFDFARAIKKVCPDAWVINYTNPMTLCTAALYKAFPEIKAFGCCHEVFHTED
ALCRIVEKEFNVPLPNRRDLRVDITGVNHFTFMTGAWWEGHDLMPIVKRIANDPATFSDH
TAIAKEREKNEKWFDCDQLVAYEFLKRFGVLGAAGDRHLAEFVPWFLKEERYLNSLGVVR
TPYSWRLKNAAEKRAKTFTDEELVAKPSGEEGVDIMMALLGGKPLKTNMNRPNEGQISYL
PKGRIVESLGLIDNDSVTPILSSDPPLAIQELVKRISDEQQIALDAIWEGDDEKLFEAFL
MDPLMDLPIDKARELFDKMLVEGRLQY

Enzyme Prediction     

No EC number prediction in MGYG000000677_01711.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	5	185	1.5e-53	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	3.26e-118	4	440	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	3.66e-90	1	442	1	431	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	1.22e-73	3	441	1	421	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	2.45e-48	5	186	1	181	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	7.34e-45	5	440	2	412	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY14443.1	7.13e-226	1	447	1	447
AEC02417.1	7.76e-216	1	447	1	447
ANX00783.1	3.45e-118	3	440	10	450
AGC67847.1	1.95e-117	3	440	10	450
ANW98258.1	1.95e-117	3	440	10	450

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	2.68e-104	1	437	3	433	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	1.30e-27	75	440	77	427	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	6.16e-25	75	447	80	436	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
6VC6_A	4.52e-16	2	437	2	427	2.1Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_B 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_C 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_D 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis]
1OBB_A	4.96e-12	1	423	1	449	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	3.62e-108	6	440	13	451	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	5.01e-108	1	444	8	447	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	1.82e-106	1	440	7	440	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
A9KTB9	1.88e-99	1	425	8	436	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
O34645	1.13e-45	5	423	3	402	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000677_01711.