CAZyme Information: MGYG000000675_01813

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_01813
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	MGYG000000675_32|CGC1	71417.32	9.457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 31844; End: 33736 Strand: +

Full Sequence      

MKKQYKSIALACCLAISCNTFTAWAQSGDEQGLEVPGNTQLPQDKEAIIKAGKGWWKESR
KNYDARMAWYNEAKFGCFIHWGVYSVPAGIWKGKKLGGYTEHLMRKGRIPLEQYKKELVA
PFNPTEFNAEEWMRHASEAGMNYFIITAKHHDGFAMYPSDAYPYDMRLTKYGKDPMEALR
KAARKYGIKFGFYYSHAFDWEHPDAPGNDWDYDNPGGDKLLGGANWWTGERKSFLPNAEK
YVEEKSIPQIQELIKKYDPDILWFDTPSKLPLYLNIRILEAIREVDPQNKIVVNGRLVRF
GSQNMGDYRNTGDRAAFFFPTKGVWESIPTTNESYGYSVVDTVRKSVPFFVQLLASAASK
GGNILMNVGPMGNGKWDARDVEVFQGIGKWLKVNGESIYGTQRTNLPVQPWGVTTLKGDT
LYAHVYRWPSDGKLVIGGLRSEIKKGWCLANKKTSVKFNRLNADDYELALPAKAPDSMDA
VIALILDKQQAPNPIRLLDARQSNILYTFDAQLQGRGLGFGDGKPNRNYVKNWKNENQSM
KWKLRLNEPAEYTVYLDYNTAGKNDTGTVIIEIAGQKFEVNYPAFYERNGSSSVLVGKVK
LDKGALECNLKGKQHTGNQYMNPIAVRLEK

Enzyme Prediction     

No EC number prediction in MGYG000000675_01813.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	49	400	1.7e-87	0.930635838150289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	2.01e-91	58	439	12	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	2.52e-87	64	396	14	333	Alpha-L-fucosidase.
COG3669	AfuC	1.93e-33	80	401	1	322	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam14871	GHL6	7.93e-07	128	265	1	134	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
pfam14488	DUF4434	9.74e-06	126	202	17	95	Domain of unknown function (DUF4434).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT26296.1	0.0	1	630	1	630
AOM78919.1	8.06e-217	14	628	13	621
ASZ11122.1	3.29e-209	15	628	853	1468
QKJ32780.1	3.72e-206	1	577	1	575
ALL05314.1	1.67e-205	38	628	33	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	1.33e-54	64	487	28	444	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
7DB5_A	1.15e-51	75	452	42	416	ChainA, Alpha-L-fucosidase [Vibrio sp. EJY3]
6HZY_A	3.29e-42	32	475	12	450	Crystalstructure of a bacterial fucosidase with inhibitor FucPUG [Bacteroides thetaiotaomicron VPI-5482],6HZY_B Crystal structure of a bacterial fucosidase with inhibitor FucPUG [Bacteroides thetaiotaomicron VPI-5482]
4PCS_A	1.56e-41	61	475	13	425	Crystalstructure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_B Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_C Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_D Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_A Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_B Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_C Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_D Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482]
2WVS_A	1.68e-41	61	475	17	429	Crystalstructure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_B Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_C Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_D Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99KR8	1.75e-40	68	437	42	405	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
C3YWU0	2.65e-40	68	441	32	398	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
Q5RFI5	2.32e-39	61	437	37	409	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
P17164	4.12e-39	69	432	48	402	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
Q9BTY2	4.48e-39	61	437	39	411	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000661	0.661151	0.337265	0.000381	0.000279	0.000239

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_01813.