CAZyme Information: MGYG000000675_00634

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_00634
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1080	MGYG000000675_8|CGC2	122834.42	6.6549

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 57786; End: 61028 Strand: -

Full Sequence      

MKKNLILLCSLLASFTLQPIQTNAQTVTNGQKLLYPYPFAPSEGLVNKTEKEHRQEICLN
GYWDFQPVALPKDYKQGKGTAPELPLPKEGDSWSATRIKVPSPWNINSFGYRDLEGPDHR
NYPSYPKEWEQVKMAWMKKNITIPANWTGQQIKLHFEAVAGYSEVYVNKKKLGENFDLFL
PFSFDITDKVTPGETVEILVGVRSQSLFEDNSTIGRRIVPGGSMWGYHINGIWQDVYLLA
LPQIHIEDVYVKPLVSKNTLEIEVTLKNKTTQKANIQLQGNVKEWINCAGTDINSAPVPA
WTLGTEALQVAPLKVSLAANETQKVTLQVPVGKNTLQYWTPEQPNLYALLLSIKDKKQTV
DTKYERFGWREWTLQGTTQCLNGEPYALHGDSWHFMGIPQMTRRYAWAWFTAIKGMNGNA
VRPHAQVYPRFYMDMADEMGICVLNETANWASDGGPKLDSEHFWESSKEHLKRFVLRDRN
HASVFGWSVSNENKPVILHVYNRPELMPTQQKAWEEWRDIVRLYDPTRPWISSDGEDDGN
GILPVTVGHYGDINSMKNWINIGKPWGIGEHSMAYYGTPEQVSKYNGERAYESQEGRMEG
LANECYNLIANQRRMGASYTTVFNMAWYALKPLPLGKRDVTKTPSVTEDGVFFGEYKEGV
PGVQPERVGPYCTTFNPGYDPTLPLYQEWPMYSALRAANAPGEPAWSPYATIDKEQYKAH
EATNATGNYKEVVYVGNPDSKIKQLMDAQGVTFASKITTPSSLLYIIDGSRALDAATQKE
LQKQLAKGADAWIWGITPETVGRYNEILPLPVALDPLKRSSFLPVQKTWMHGLNNSDFYF
CELQKADASEYSLKGAFVEEGDVLLNACKTDWRKWNKRPEEIKTAGTIRSEYECTSATPV
FVKYREGASTFYLSTLTEFANSEKGYNTLSAILKNAGIQSQKPETDINEVFFLRDEQMNF
PVATKDKFVKENDSRTLEFYVFSPRPLDDLLIEPNMPKLSLMLKAKKRELFINDKPYTSV
SHNGRNEIIYKELPLLQGWNKFIIKIGEGDRNDFTGFFKCDNKQDFLPTLKAAFINPEDK

Enzyme Prediction     

No EC number prediction in MGYG000000675_00634.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	46	648	6.2e-86	0.5930851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.15e-37	54	509	10	426	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.46e-31	59	492	44	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	1.72e-30	49	529	5	444	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	2.34e-16	59	242	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK09525	lacZ	2.48e-16	25	492	20	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU96986.1	0.0	1	1080	1	1080
QGT71549.1	0.0	1	1080	1	1080
QUT39621.1	0.0	1	1080	3	1085
QUT72084.1	0.0	1	1080	3	1085
BCA51180.1	0.0	1	1080	3	1085

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	4.04e-32	50	492	32	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	4.04e-32	50	492	31	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
5T98_A	5.37e-25	89	529	50	446	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7VQM_A	1.73e-22	53	526	10	456	ChainA, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_B Chain B, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_C Chain C, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_D Chain D, GH2 beta-galacturonate AqGalA [Aquimarina sp.]
5C70_A	1.79e-22	54	529	18	449	Thestructure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	2.21e-31	50	492	32	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	1.44e-25	38	493	40	482	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
P77989	5.70e-24	125	529	48	411	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	2.60e-23	45	548	38	472	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q7MG04	4.49e-23	38	562	29	522	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999001	0.000199	0.000191	0.000175	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_00634.