CAZyme Information: MGYG000000675_00188

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_00188
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	MGYG000000675_2|CGC3	59542.89	6.125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 102629; End: 104218 Strand: +

Full Sequence      

MKGKTLLAALGFFSIAGMAGGCSSRPAPDINFQIETDKPCQTMAYFGASDAWSMQFIGLW
PQEKQNQVADWLFSTGNDANGKPKGIGLSLWRFNVGAGSTEQGEASQIASPWMRAECFLN
ADGTYDWNKQQGQRNFLKLAKERGVNKFLAFLNSPPVYYTQNGLATNTGRGGTANLKSDC
YEKYARFLADVVQGVEKHDGIKFNYICPFNEPDGHWNWVGPKQEGCPATNREVAHTVRLL
SKEFVNRNMDTQILVNESSDYRCMFRTHETDWQRGYQIQAFFCPDSVDTYLGDIPNVPRL
MIGHSYWTTTPLSELRNIRCQLRDTLDKHNVDFWQTETCIMGNDEEIGGGNGFDRTMKTA
LYVARIIHHDIVYAGAKSWQWWRAIGGDYKDGLIREYTTDGNFLDGRVEDSKLMWALGNY
SRFIRPGAVRLSVSTFDKTGTLIPDGDTDQQGLMCTAYKNTDGTYVMVVVNYTNEEKEFS
INEEKVGNAQWQIYRTSDKEGEDLLPVGTVKSGKTVQIPARSIITLQGK

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	31	526	2.4e-198	0.993801652892562

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.54e-146	32	394	4	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	6.00e-17	1	482	1	406	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	1.85e-09	427	526	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93355.1	0.0	1	529	1	528
QDH57504.1	0.0	1	529	1	528
QGT72499.1	0.0	1	527	1	526
ALJ47685.1	0.0	1	529	4	531
QUT79243.1	0.0	1	527	1	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	5.51e-91	32	526	8	494	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	1.21e-12	41	525	34	450	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	2.04e-11	46	526	19	445	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	6.79e-11	46	526	26	452	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
1NOF_A	1.16e-10	147	497	77	349	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	1.45e-18	23	273	15	268	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	2.20e-11	46	526	43	469	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000043	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_00188.