CAZyme Information: MGYG000000674_00446

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1810; UMGS1810
• CAZyme ID: MGYG000000674_00446
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803	MGYG000000674_21|CGC1	90992.4	6.0892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000674	2404419	MAG	Kazakhstan	Asia

• Gene Location: Start: 8729; End: 11140 Strand: -

Full Sequence      

MNLDQKSAMKLLDEKCKNNFGCAISDATQHQVYMTACMVVRDILSEKNMEFNKTAGKKEE
KQVFYMSMEFLVGTSLHNNLYNLGVEDAFKKALKSIDVDIEDIYKIEPDAGLGNGGLGRL
ASCYMDSLTSLAIPATGYSIRYEFGIFKQKIIDGWQMEFPDDWLNLGDVWLKGRPDESVE
VKFGGHVNEWFDDKGYHAEHVDYTVVLAVPYDMLISGYNTPAVNKLVLWSAKSPKSFDMT
AFSRGDYAKAIEENTKAEVISKVLYPADDHIEGKILRLKQQYFFVSASLQTITKKHFAKY
KTLDNLSDKVSIHINDTHPALCVPELMRILMDIYGYGWDDAWDITCKTLSYTNHTVMSEA
LERWNEHMFNDQLPRIYQIVAEINRRLLIQLNNVYPGDYAKIDYMAVIANGEIRMANMCL
AACHMVNGVSKLHSEILKTSIFKDYYNISPEKFTNVTNGIAYRRWLCQSNPLLTDYLTEL
IGDGFKKDSKNLEKLLKYHGDKQVADKLFDIKKANKQRLADYILQANGIKVDADSIFDVQ
IKRLHEYKRQLLNVLQILHMYLKIKENPNMDFKPRTFIFAAKASAGYFMAKQIIRLICAV
SNTVNSDPAVRDKLKVVFIEDYKVSLAEIIIPAADISEQISIAGKEASGTGNMKLMINGA
VTLGTLDGANVEIFEQVGKDNIFLFGLKADEVDALWRQGYSPFDYVNGNSDLKAVLDLLT
SNVLGARFDDIAKSLLTNAFGTADAYMTLADYDSYVKAQELVSKTYADKYKFMDMSLTNI
AKAGIFSSDRAIEEYAENIWHCK

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	92	802	3.7e-264	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	27	803	36	811	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	24	801	25	747	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	25	803	27	797	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	24	801	13	793	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	10	801	2	794	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX62808.1	0.0	10	803	12	807
AVQ97458.1	0.0	15	801	17	802
AYF42955.1	0.0	15	801	17	802
QCN93713.1	0.0	15	801	17	802
AYF40115.1	0.0	15	801	17	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Z8D_A	2.59e-249	27	800	47	826	ChainA, Glycogen phosphorylase, muscle form [Homo sapiens]
2FFR_A	9.52e-248	27	800	35	814	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
2GJ4_A	1.84e-247	27	800	35	814	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	1.91e-247	27	800	35	814	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
7O8E_A	2.25e-247	27	800	40	819	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P11217	1.76e-249	27	800	47	826	Glycogen phosphorylase, muscle form OS=Homo sapiens OX=9606 GN=PYGM PE=1 SV=6
P73511	1.79e-248	27	803	48	827	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1
Q9XTL9	8.60e-248	27	800	47	826	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2
Q9WUB3	6.47e-247	27	800	47	826	Glycogen phosphorylase, muscle form OS=Mus musculus OX=10090 GN=Pygm PE=1 SV=3
O18751	9.16e-247	27	800	47	826	Glycogen phosphorylase, muscle form OS=Ovis aries OX=9940 GN=PYGM PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000674_00446.