CAZyme Information: MGYG000000672_01056

Basic Information

• Species: RC9 sp000431015
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000431015
• CAZyme ID: MGYG000000672_01056
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000000672_8|CGC2	41502.57	7.1057

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000672	2733599	MAG	Kazakhstan	Asia

• Gene Location: Start: 73581; End: 74678 Strand: -

Full Sequence      

MILKRICCLAAALAIVVPSFAGINRNDVKEIADRVADWQIANFKNVSYTGKKRAPLDWAN
GALFRGMVEWSAKTGYQPAEDFVMNIAKTHDWHMARRLYHADDICVGQAFLLLYEKYKDP
VMLQYVKERADSVIDFRSHVAMDIHVKGGQERWCWCDALFMAPPVYSKLTQITGDRKYVD
FMNEEFVATTNHLFDTEYKLYYRDARFFDKTEANGAKVFWGRGNGWCYAGLTFLLETTPE
SDPMYDYFKSLYLKMTEAVLKCQDANGSWHASLLAPENYPTAENSSSGFMTYGLAWGVNH
GILKGKVYRKAVEKGWKALCSYVREDGKLEYVQPVAGSPGKITKDMTEVYGVGAFLLAAT
EMLDF

Enzyme Prediction     

No EC number prediction in MGYG000000672_01056.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	52	363	9.1e-84	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.39e-91	31	363	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.73e-48	34	363	10	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA08868.1	3.24e-134	29	363	28	357
AAO78027.1	3.24e-134	29	363	28	357
QMW85349.1	3.24e-134	29	363	28	357
ASM64975.1	8.10e-130	31	363	30	357
QUU06691.1	8.10e-130	31	363	30	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	3.25e-70	55	363	50	367	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	3.86e-46	58	365	56	374	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	7.10e-44	36	365	42	357	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	3.32e-84	29	363	58	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	2.16e-69	55	363	57	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.33e-67	11	363	17	373	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000278	0.999013	0.000192	0.000175	0.000170	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000672_01056.