CAZyme Information: MGYG000000659_01129

Basic Information

• Species: UBA10281 sp900556195
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900556195
• CAZyme ID: MGYG000000659_01129
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428		48870.91	4.9802

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000659	1920550	MAG	Germany	Europe

• Gene Location: Start: 7435; End: 8721 Strand: +

Full Sequence      

MSKVLTLSKKQLEYLEWEFGVFFHFGIRSFYPGHKDWDGLDMPLSGFNPTDLNADEWCQT
AKNAGATYVLLTCKHHDGFALWQSGYTEYGVKNTPWKGGKGDVVREYVDAARRAGLKVGL
YYSPAQWGATAVKFENGKEYDDYFINQISELLTGYGKIDYLWFDGCGSEDHEYDKKRIVN
EIFRLQPDILTFCNADWYPTVRWIGNEDGYASMNNPLVVRSIYFSELATKADTFPEDTCI
PAECDAKMRNSWFFDNNEDTLKSLDELFGMYEASVGNGSNFLLNISPDDRGRLPEADKNR
LLELGEKIRKYETPTGGFGNAYKDGEKEYSIKSAEYDMPWGTRGKNPQVINRIVIEEDLT
DGQNVKAFDVYFYPSVYKDRKLLVYRGATIGRKTICHIPAIYASKITVEITESDGEAKIK
SIKTYKVN

Enzyme Prediction     

No EC number prediction in MGYG000000659_01129.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	9	311	1.8e-77	0.8670520231213873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	4.73e-67	8	425	12	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	4.30e-44	8	311	12	331	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	4.19e-40	19	311	28	333	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95058.1	9.93e-142	1	425	1	414
BBH22425.1	2.41e-126	2	427	4	415
ASK62228.1	5.53e-123	8	425	9	409
AZN39798.1	8.45e-123	8	425	10	416
QHT59657.1	8.08e-121	8	425	20	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	3.68e-69	5	425	30	458	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	2.55e-63	8	413	20	464	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	7.36e-63	8	413	22	466	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	2.87e-61	8	413	20	464	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3EYP_A	3.45e-60	5	297	8	308	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	8.74e-58	4	414	34	468	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.84e-49	8	410	41	461	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	4.20e-15	18	305	41	350	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q6AYS4	9.95e-15	18	315	46	364	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q99KR8	1.00e-14	22	315	80	366	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000659_01129.