CAZyme Information: MGYG000000655_01551

Basic Information

• Species: Holdemanella sp900547815
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemanella; Holdemanella sp900547815
• CAZyme ID: MGYG000000655_01551
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487	MGYG000000655_49|CGC1	56234.45	4.9792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000655	2321148	MAG	Germany	Europe

• Gene Location: Start: 6424; End: 7887 Strand: +

Full Sequence      

MAEFTKGFLWGGATADFQYEGGFNEGGKGLSTHDFETDGSLEKPRMITLELADGTRGEVP
TRESFPDGAEAKIYDDQYYPSHKAVDFYHHYKEDIALMGEMGFNVFRFSICWPRIFPTGD
ELEPNEEGLKFYDDVITELEKYNIQPLITICHDELPDYLARKYDGWSSRHVIDCYVRYAT
TVLERYKGRCKYWLTFNEINAVNGYAQIGTHKQDEQTVYQAKHHMFVASAKVVKIAHEID
PGNMVGTMYALSQMYPKTCDPQDIMASYMKRRNNLWFIDIMARGYYPNFTDQFFEERGVK
LVKEPGDDEILREGTLDMVTFSYYRSMTISKDTKLTWAMGLLGGDPNPYLESTKWGWPID
PIGLRYTLNELYDRYQKPLFVVENGLGEIDVKEADGTVNDDYRIKYLAQHFEEMKKAVNF
DKVPVLGYTMWGNTDLVSLSTGEMKKRYGFVYVDLDDKGNGTGERSKKKSFEWMKKVCHT
NGGDLSY

Enzyme Prediction     

No EC number prediction in MGYG000000655_01551.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	482	1.8e-138	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	485	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	486	1	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	486	1	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	4	486	6	478	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.14e-178	6	485	8	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT48977.1	4.45e-246	1	485	1	481
QPS12506.1	2.16e-227	1	482	1	479
QMW74220.1	2.16e-227	1	482	1	479
QQY28707.1	2.16e-227	1	482	1	479
QQV07467.1	2.16e-227	1	482	1	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	1.25e-168	6	485	10	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	2.53e-168	3	485	7	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.62e-151	1	485	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.59e-151	1	485	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	8.92e-146	2	485	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	6.85e-168	6	485	10	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P24240	1.75e-164	1	485	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	8.45e-164	3	485	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	1.79e-160	1	485	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46130	1.23e-151	3	485	6	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000655_01551.